4WNG: TPR domain of LGN

Crystal structure of the TPR domain of LGN in complex with Frmpd4/Preso1 at 2.1 Angstrom resolution. Determined by X-ray diffraction at 2.11 Å resolution. Released 16 Sept 2015.

Method: X-ray diffraction
Resolution: 2.11 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,674
Mol. weight: 51.89 kDa
Released: 16 Sept 2015

Explore 4WNG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WNG contains 17 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	13-29	17
α-helix	33-46	14
α-helix	51-67	17
α-helix	71-88	18
α-helix	91-108	18
α-helix	111-127	17
α-helix	131-150	20
α-helix	165-188	24
α-helix	191-207	17
α-helix	211-228	18
α-helix	231-247	17
α-helix	251-267	17
α-helix	271-287	17
α-helix	291-306	16
α-helix	311-328	18
α-helix	331-346	16

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	997-1001	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
G-protein-signaling modulator 2	A	protein	407	Homo sapiens	P81274 (AlphaFold model)
FERM and PDZ domain-containing protein 4	B	protein	60	Homo sapiens	Q14CM0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4WNG_1 G-protein-signaling modulator 2 (chains A)
GPLGSMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGNAYFY
LHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRE
LNDKVGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQAAVDFYEENLSLVTA
LGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIF
LGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQE
LNDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDKSGELTARLNLSDLQMV
LGLSYSTNNSIMSENTEIDSSLNGVRPKLGRRHSMENMELMKLTPEK

Sequence of entity 2 (B), FASTA

>4WNG_2 FERM and PDZ domain-containing protein 4 (chains B)
GPGSDLPPKVVPSKQLLHSDHMEMEPETMETKSVTDYFSKLHMGSVAYSCTSEFHHHHHH

Primary citation

Structural basis for the recognition of the scaffold protein Frmpd4/Preso1 by the TPR domain of the adaptor protein LGN. Takayanagi, H., Yuzawa, S., Sumimoto, H. Acta Crystallogr F Struct Biol Commun (2015) 71:175-183. DOI 10.1107/S2053230X14028143 · PubMed

Other PDB entries of the same protein (UniProt P81274 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WND 1.5 Å, Crystal structure of the TPR domain of LGN in complex with Frmpd4/Preso1 at 1.5 Angstrom…
4WNE 2.0 Å, Crystal structure of the TPR domain of LGN in complex with Frmpd4/Preso1 at 2.0 Angstrom…
3SF4 2.6 Å, Crystal structure of the complex between the conserved cell polarity proteins…
4WNF 2.9 Å, Crystal structure of the oxidized TPR domain of LGN in complex with Frmpd4/Preso1 at 2.9…
5A6C 2.9 Å, Concomitant binding of Afadin to LGN and F-actin directs planar spindle orientation
6HC2 4.31 Å, Crystal structure of NuMA/LGN hetero-hexamers

Browse structure collections

About this viewer

MolViewer shows 4WNG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.