7BZO: Mature Coxsackievirus A10 at pH 5.5

Name: PDB 7BZO: Cryo-EM structure of mature Coxsackievirus A10 at pH 5.5
Published: 2020-07-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: virus

Cryo-EM structure of mature Coxsackievirus A10 at pH 5.5. Determined by electron microscopy at 3.2 Å resolution. Released 22 Jul 2020.

Method: Electron microscopy
Resolution: 3.2 Å
Organism: Coxsackievirus A10
Chains: 4
Atoms: 6,180
Mol. weight: 94.94 kDa
Ligands: SPH
Released: 22 Jul 2020

Explore 7BZO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BZO contains 31 α-helices and 57 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	24-25	2	1
β-strand	32	1	2
β-strand	47	1	3
α-helix	50-52	3
α-helix	60-62	3
β-strand	69	1	2
α-helix	76-78	3
β-strand	79	1	4
α-helix	80-84	5
β-strand	91-96	6	5
β-strand	105-109	5	6
α-helix	118-122	5
β-strand	125-131	7	7
β-strand	132-140	9	5
β-strand	149-155	7	6
α-helix	160-162	3
α-helix	168-171	4
β-strand	177-181	5	6
α-helix	185-186	2
β-strand	187-191	5	5
β-strand	200-201	2	7
β-strand	206	1	8
β-strand	231-236	6	6
β-strand	245-252	8	5
β-strand	255-262	8	7
α-helix	264-266	3
α-helix	269-270	2
β-strand	278	1	9
α-helix	283-285	3

Chain B: 11 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	10
β-strand	21-25	5	10
α-helix	30-31	2
β-strand	32-33	2	11
α-helix	34-36	3
α-helix	41-43	3
α-helix	52-53	2
β-strand	54	1	12
β-strand	64-65	2	11
α-helix	67-68	2
β-strand	69-71	3	13
β-strand	78-79	2	14
α-helix	82-85	4
α-helix	90-98	9
β-strand	101-103	3	12
β-strand	106-111	6	11
β-strand	119	1	15
β-strand	121-126	6	14
α-helix	131-134	4
β-strand	135	1	9
α-helix	149-152	4
β-strand	159-160	2	14
α-helix	173-178	6
β-strand	181-185	5	14
β-strand	191-196	6	11
β-strand	205	1	12
β-strand	210	1	8
β-strand	215-219	5	14
α-helix	222-223	2
β-strand	224	1	15
β-strand	233-235	3	13
β-strand	236-240	5	11
β-strand	245-247	3	12

Chain C: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	22-23	2	5
α-helix	31-33	3
β-strand	39-40	2	7
β-strand	42	1	4
α-helix	43-45	3
β-strand	51-52	2	3
α-helix	64-67	4
β-strand	69-72	4	3
β-strand	80-85	6	16
α-helix	93-95	3
α-helix	99-102	4
β-strand	106-110	5	17
β-strand	113-120	8	3
β-strand	128-134	7	16
α-helix	144-147	4
β-strand	151-156	6	16
β-strand	162-167	6	3
β-strand	176-177	2	17
β-strand	191-195	5	16
β-strand	209-218	10	3
β-strand	223-227	5	17

Chain D: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	36-38	3
β-strand	47-48	2	1
α-helix	50-52	3
β-strand	57	1	11
α-helix	60-62	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Capsid protein VP1	A	protein	298	Coxsackievirus A10	A0A0C5AWF6
Capsid protein VP2	B	protein	255	Coxsackievirus A10	G0YPI2
Capsid protein VP3	C	protein	240	Coxsackievirus A10	G0YPI2
Capsid protein VP4	D	protein	69	Coxsackievirus A10	G0YPI2

Sequence of entity 1 (A), FASTA

>7BZO_1 Capsid protein VP1 (chains A)
GDPVEDIIHDALGSTARRAISSVTNAESAANTTPSSHRLETGRVPALQAAETGATSNATD
ENMIETRCVVNRNGVLETTINHFFSRSGLVGVVNLTDGGTDTTGYATWDIDIMGFVQLRR
KCEMFTYMRFNAEFTFVTTTKNGEARPYMLQYMYVPPGAPKPTGRDAFQWQTATNPSVFV
KLTDPPAQVSVPFMSPASAYQWFYDGYPTFGQHPETSNTTYGLCPNNMMGTFAVRVVSRE
ASQLKLQTRVYMKLKHVRAWVPRPIRSQPYLLKNFPNYDSSKITNSARDRSSIKQANM

Sequence of entity 2 (B), FASTA

>7BZO_2 Capsid protein VP2 (chains B)
SPSVEACGYSDRVAQLTVGNSSITTQEAANIVLAYGEWPEYCPDTDATAVDKPTRPDVSV
NRFYTLDSKMWQENSTGWYWKFPDVLNKTGVFGQNAQFHYLYRSGFCLHVQCNASKFHQG
ALLVAVIPEFVIAGRGSNTKPNEAPHPGFTTTFPGTTGATFHDPYVLDSGVPLSQALIYP
HQWINLRTNNCATVIVPYINAVPFDSAINHSNFGLIVIPVSPLKYSSGATTAIPITITIA
PLNSEFGGLRQAVSQ

Sequence of entity 3 (C), FASTA

>7BZO_3 Capsid protein VP3 (chains C)
GIPAELRPGTNQFLTTDDDTAAPILPGFTPTPTIHIPGEVHSLLELCRVETILEVNNTTE
ATGLTRLLIPVSSQNKADELCAAFMVDPGRIGPWQSTLVGQICRYYTQWSGSLKVTFMFT
GSFMATGKMLVAYSPPGSAQPANRETAMLGTHVIWDFGLQSSVSLVIPWISNTHFRTAKT
GGNYDYYTAGVVTLWYQTNYVVPPETPGEAYIIAMGAAQDNFTLKICKDTDEVTQQAVLQ

Sequence of entity 4 (D), FASTA

>7BZO_4 Capsid protein VP4 (chains D)
MGAQVSTQKSGSHETGNVATGGSTINFTNINYYKDSYAASATRQDFTQDPKKFTQPVLDS
IRELSAPLN

Ligands and cofactors

ID	Name	Formula	Copies
SPH	Sphingosine	C18 H37 N O2	1

Primary citation

Molecular basis of Coxsackievirus A10 entry using the two-in-one attachment and uncoating receptor KRM1. Cui, Y., Peng, R., Song, H. et al. Proc Natl Acad Sci U S A (2020) 117:18711-18718. DOI 10.1073/pnas.2005341117 · PubMed

Other PDB entries of the same protein (UniProt A0A0C5AWF6), best resolution first:

6AKU 2.7 Å, Cryo-EM structure of CVA10 empty particle
6AKT 2.8 Å, Cryo-EM structure of CVA10 A-particle
6AKS 3.0 Å, Cryo-EM structure of CVA10 mature virus
7BZT 3.0 Å, Cryo-EM structure of mature Coxsackievirus A10 in complex with KRM1 at pH 7.4
7BZU 3.0 Å, Cryo-EM structure of mature Coxsackievirus A10 in complex with KRM1 at pH 5.5
7BZN 3.1 Å, Cryo-EM structure of mature Coxsackievirus A10 at pH 7.4
7C4Z 3.3 Å, Cryo-EM structure of empty Coxsackievirus A10 at pH 5.5
7C4W 3.4 Å, Cryo-EM structure of A particle Coxsackievirus A10 at pH 5.5
7C4Y 3.5 Å, Cryo-EM structure of empty Coxsackievirus A10 at pH 7.4
7C4T 3.6 Å, Cryo-EM structure of A particle Coxsackievirus A10 at pH 7.4

Browse structure collections

About this viewer

MolViewer shows 7BZO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.