7BZU: Mature Coxsackievirus A10
Cryo-EM structure of mature Coxsackievirus A10 in complex with KRM1 at pH 5.5. Determined by electron microscopy at 3.0 Å resolution. Released 22 Jul 2020.
- Method
- Electron microscopy
- Resolution
- 3.0 Å
- Organisms
- Coxsackievirus A10, Homo sapiens
- Chains
- 5
- Atoms
- 8,557
- Mol. weight
- 136.8 kDa
- Ligands
- NAG
- Released
- 22 Jul 2020
Explore 7BZU in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7BZU contains 32 α-helices and 87 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 10 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 28 | 1 | 1 |
| β-strand | 32 | 1 | 2 |
| α-helix | 50-52 | 3 | |
| α-helix | 54-56 | 3 | |
| β-strand | 69 | 1 | 2 |
| β-strand | 74 | 1 | 1 |
| β-strand | 79 | 1 | 3 |
| α-helix | 80-83 | 4 | |
| β-strand | 89-95 | 7 | 4 |
| β-strand | 108-109 | 2 | 5 |
| α-helix | 116-122 | 7 | |
| β-strand | 125-132 | 8 | 6 |
| β-strand | 135-140 | 6 | 4 |
| β-strand | 149-155 | 7 | 5 |
| α-helix | 160-162 | 3 | |
| α-helix | 168-171 | 4 | |
| β-strand | 177-181 | 5 | 5 |
| α-helix | 185-186 | 2 | |
| β-strand | 187-188 | 2 | 4 |
| β-strand | 189-190 | 2 | 7 |
| β-strand | 191 | 1 | 6 |
| β-strand | 200-201 | 2 | 6 |
| β-strand | 206 | 1 | 8 |
| α-helix | 225-227 | 3 | |
| β-strand | 231-236 | 6 | 5 |
| β-strand | 246-251 | 6 | 4 |
| β-strand | 254-262 | 9 | 6 |
| α-helix | 264-266 | 3 | |
| β-strand | 277-278 | 2 | 9 |
| α-helix | 283-285 | 3 | |
Chain B: 9 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 14-18 | 5 | 10 |
| β-strand | 21-25 | 5 | 10 |
| α-helix | 30-31 | 2 | |
| β-strand | 32-33 | 2 | 11 |
| α-helix | 34-36 | 3 | |
| α-helix | 41-43 | 3 | |
| α-helix | 52-53 | 2 | |
| β-strand | 54 | 1 | 12 |
| β-strand | 64-65 | 2 | 11 |
| β-strand | 69-70 | 2 | 13 |
| β-strand | 78-79 | 2 | 14 |
| α-helix | 82-85 | 4 | |
| α-helix | 90-98 | 9 | |
| β-strand | 99-103 | 5 | 12 |
| β-strand | 106-111 | 6 | 11 |
| β-strand | 119-128 | 10 | 14 |
| α-helix | 131-133 | 3 | |
| β-strand | 134-135 | 2 | 9 |
| α-helix | 149-152 | 4 | |
| β-strand | 159-160 | 2 | 14 |
| α-helix | 164-166 | 3 | |
| β-strand | 181-185 | 5 | 14 |
| β-strand | 191-192 | 2 | 11 |
| β-strand | 194-196 | 3 | 11 |
| β-strand | 205 | 1 | 12 |
| β-strand | 210 | 1 | 8 |
| β-strand | 213-224 | 12 | 14 |
| β-strand | 234-235 | 2 | 13 |
| β-strand | 236-240 | 5 | 11 |
| β-strand | 245-249 | 5 | 12 |
Chain C: 7 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 22-23 | 2 | 7 |
| α-helix | 31-33 | 3 | |
| β-strand | 39-40 | 2 | 6 |
| β-strand | 42 | 1 | 3 |
| α-helix | 44-47 | 4 | |
| β-strand | 51-52 | 2 | 15 |
| α-helix | 64-67 | 4 | |
| β-strand | 69-71 | 3 | 15 |
| β-strand | 80-85 | 6 | 16 |
| α-helix | 93-95 | 3 | |
| α-helix | 98-105 | 8 | |
| β-strand | 106 | 1 | 17 |
| β-strand | 108-110 | 3 | 18 |
| β-strand | 113-119 | 7 | 15 |
| β-strand | 126-134 | 9 | 16 |
| α-helix | 144-147 | 4 | |
| β-strand | 151-156 | 6 | 16 |
| β-strand | 162-167 | 6 | 15 |
| β-strand | 176-177 | 2 | 18 |
| α-helix | 185-187 | 3 | |
| β-strand | 191-201 | 11 | 16 |
| β-strand | 210-218 | 9 | 15 |
| β-strand | 223-224 | 2 | 18 |
| β-strand | 227 | 1 | 17 |
Chain D: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 51-54 | 4 | |
| β-strand | 57 | 1 | 11 |
Chain E: 5 helices, 28 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 46 | 1 | 19 |
| β-strand | 54 | 1 | 19 |
| β-strand | 55 | 1 | 20 |
| α-helix | 56-57 | 2 | |
| β-strand | 85 | 1 | 21 |
| β-strand | 94-96 | 3 | 21 |
| β-strand | 97 | 1 | 20 |
| α-helix | 98 | 1 | |
| β-strand | 106-108 | 3 | 21 |
| β-strand | 119-124 | 6 | 22 |
| β-strand | 136 | 1 | 23 |
| α-helix | 144-152 | 9 | |
| β-strand | 158-161 | 4 | 22 |
| β-strand | 168 | 1 | 23 |
| β-strand | 170 | 1 | 22 |
| β-strand | 180 | 1 | 22 |
| α-helix | 181-182 | 2 | |
| β-strand | 189 | 1 | 24 |
| β-strand | 197 | 1 | 24 |
| β-strand | 200 | 1 | 22 |
| β-strand | 203-208 | 6 | 22 |
| β-strand | 216-218 | 3 | 25 |
| β-strand | 224-226 | 3 | 26 |
| α-helix | 227 | 1 | |
| β-strand | 239-245 | 7 | 25 |
| β-strand | 251-255 | 5 | 26 |
| β-strand | 259 | 1 | 27 |
| β-strand | 267-272 | 6 | 25 |
| β-strand | 277-283 | 7 | 25 |
| β-strand | 293-294 | 2 | 26 |
| β-strand | 298-304 | 7 | 25 |
| β-strand | 314 | 1 | 27 |
| β-strand | 315-321 | 7 | 26 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Capsid protein VP1 | A | protein | 298 | Coxsackievirus A10 | A0A0C5AWF6 |
| Capsid protein VP2 | B | protein | 255 | Coxsackievirus A10 | G0YPI2 |
| Capsid protein VP3 | C | protein | 240 | Coxsackievirus A10 | G0YPI2 |
| Capsid protein VP4 | D | protein | 69 | Coxsackievirus A10 | G0YPI2 |
| KRM1 | E | protein | 375 | Homo sapiens | Q96MU8 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>7BZU_1 Capsid protein VP1 (chains A)
GDPVEDIIHDALGSTARRAISSVTNAESAANTTPSSHRLETGRVPALQAAETGATSNATD
ENMIETRCVVNRNGVLETTINHFFSRSGLVGVVNLTDGGTDTTGYATWDIDIMGFVQLRR
KCEMFTYMRFNAEFTFVTTTKNGEARPYMLQYMYVPPGAPKPTGRDAFQWQTATNPSVFV
KLTDPPAQVSVPFMSPASAYQWFYDGYPTFGQHPETSNTTYGLCPNNMMGTFAVRVVSRE
ASQLKLQTRVYMKLKHVRAWVPRPIRSQPYLLKNFPNYDSSKITNSARDRSSIKQANM
Sequence of entity 2 (B), FASTA
>7BZU_2 Capsid protein VP2 (chains B)
SPSVEACGYSDRVAQLTVGNSSITTQEAANIVLAYGEWPEYCPDTDATAVDKPTRPDVSV
NRFYTLDSKMWQENSTGWYWKFPDVLNKTGVFGQNAQFHYLYRSGFCLHVQCNASKFHQG
ALLVAVIPEFVIAGRGSNTKPNEAPHPGFTTTFPGTTGATFHDPYVLDSGVPLSQALIYP
HQWINLRTNNCATVIVPYINAVPFDSAINHSNFGLIVIPVSPLKYSSGATTAIPITITIA
PLNSEFGGLRQAVSQ
Sequence of entity 3 (C), FASTA
>7BZU_3 Capsid protein VP3 (chains C)
GIPAELRPGTNQFLTTDDDTAAPILPGFTPTPTIHIPGEVHSLLELCRVETILEVNNTTE
ATGLTRLLIPVSSQNKADELCAAFMVDPGRIGPWQSTLVGQICRYYTQWSGSLKVTFMFT
GSFMATGKMLVAYSPPGSAQPANRETAMLGTHVIWDFGLQSSVSLVIPWISNTHFRTAKT
GGNYDYYTAGVVTLWYQTNYVVPPETPGEAYIIAMGAAQDNFTLKICKDTDEVTQQAVLQ
Sequence of entity 4 (D), FASTA
>7BZU_4 Capsid protein VP4 (chains D)
MGAQVSTQKSGSHETGNVATGGSTINFTNINYYKDSYAASATRQDFTQDPKKFTQPVLDS
IRELSAPLN
Sequence of entity 5 (E), FASTA
>7BZU_5 KRM1 (chains E)
APSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGE
HNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSN
KLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGG
DGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFD
IRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQA
VKEEGSENLYFQGGSLPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQ
TVPGTHHHHHHHHHH
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
Primary citation
Molecular basis of Coxsackievirus A10 entry using the two-in-one attachment and uncoating receptor KRM1. Cui, Y., Peng, R., Song, H. et al. Proc Natl Acad Sci U S A (2020) 117:18711-18718. DOI 10.1073/pnas.2005341117 · PubMed
Other PDB entries of the same protein (UniProt A0A0C5AWF6), best resolution first:
- 6AKU 2.7 Å, Cryo-EM structure of CVA10 empty particle
- 6AKT 2.8 Å, Cryo-EM structure of CVA10 A-particle
- 6AKS 3.0 Å, Cryo-EM structure of CVA10 mature virus
- 7BZT 3.0 Å, Cryo-EM structure of mature Coxsackievirus A10 in complex with KRM1 at pH 7.4
- 7BZN 3.1 Å, Cryo-EM structure of mature Coxsackievirus A10 at pH 7.4
- 7BZO 3.2 Å, Cryo-EM structure of mature Coxsackievirus A10 at pH 5.5
- 7C4Z 3.3 Å, Cryo-EM structure of empty Coxsackievirus A10 at pH 5.5
- 7C4W 3.4 Å, Cryo-EM structure of A particle Coxsackievirus A10 at pH 5.5
- 7C4Y 3.5 Å, Cryo-EM structure of empty Coxsackievirus A10 at pH 7.4
- 7C4T 3.6 Å, Cryo-EM structure of A particle Coxsackievirus A10 at pH 7.4
Browse structure collections
About this viewer
MolViewer shows 7BZU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.