7C6A: AT2R-BRIL and SRP2070_Fab complex

Crystal structure of AT2R-BRIL and SRP2070_Fab complex. Determined by X-ray diffraction at 3.4 Å resolution. Released 29 Jul 2020.

Method: X-ray diffraction
Resolution: 3.4 Å
Organisms: Mus musculus, Homo sapiens, Escherichia coli
Chains: 4
Atoms: 6,352
Mol. weight: 96.98 kDa
Released: 29 Jul 2020

Explore 7C6A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7C6A contains 31 α-helices and 58 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	43-45	3
α-helix	47-72	26
α-helix	78-93	16
α-helix	94-96	3
α-helix	97-105	9
α-helix	114-147	34
α-helix	160-173	14
α-helix	176-181	6
β-strand	182-187	6	19
β-strand	192-197	6	19
α-helix	201-203	3
α-helix	204-215	12
α-helix	216-221	6
α-helix	222-237	16
α-helix	1004-1018	15
α-helix	1023-1042	20
α-helix	1063-1079	17
α-helix	1084-284	62
α-helix	290-315	26
α-helix	316-320	5

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	4	1	19

Chain H: 7 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	9
α-helix	6-8	3
β-strand	11-12	2	10
β-strand	18-20	3	11
β-strand	23-25	3	9
α-helix	29-31	3
β-strand	34-38	5	12
β-strand	39	1	13
β-strand	41	1	14
β-strand	43	1	14
β-strand	46-51	6	12
β-strand	58-60	3	12
α-helix	62-65	4
β-strand	68	1	11
β-strand	71-73	3	9
β-strand	78-80	3	9
β-strand	81-83	3	11
α-helix	88-90	3
β-strand	92-94	3	13
β-strand	96-97	2	12
β-strand	98	1	15
α-helix	99-100	2
β-strand	108	1	15
β-strand	113-115	3	13
β-strand	116-117	2	10
β-strand	123	1	16
β-strand	126-130	5	17
β-strand	141-151	11	17
β-strand	152	1	16
β-strand	157-160	4	18
α-helix	161-163	3
β-strand	169-176	8	17
β-strand	181-190	10	17
β-strand	200-205	6	18
α-helix	206-208	3
β-strand	210-215	6	18

Chain L: 6 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	12-13	2	2
β-strand	19	1	1
β-strand	22-25	4	1
β-strand	30	1	3
β-strand	33-38	6	4
α-helix	42-44	3
β-strand	45-49	5	4
β-strand	53-54	2	4
α-helix	55	1
β-strand	62-67	6	1
β-strand	68	1	3
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84	1	5
β-strand	85-90	6	4
α-helix	96	1
β-strand	97-98	2	4
β-strand	104	1	5
β-strand	105-106	2	2
β-strand	111	1	6
β-strand	114-118	5	7
α-helix	122-126	5
β-strand	130-139	10	7
β-strand	140	1	6
β-strand	145-150	6	8
β-strand	153-155	3	8
β-strand	159-163	5	7
β-strand	173-181	9	7
α-helix	183-186	4
β-strand	191-197	7	8
β-strand	205-210	6	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IgG Light Chain	L	protein	214	Mus musculus
IgG heavy chain	H	protein	224	Mus musculus
Type-2 angiotensin II receptor,Soluble cytochrome b562,Type-2 angiotensin II receptor	A	protein	422	Homo sapiens, Escherichia coli	P0ABE7 (AlphaFold model), P50052 (AlphaFold model)
SAR1, ILE8-angiotensin II	B	protein	8	Homo sapiens	P01019 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>7C6A_1 IgG Light Chain (chains L)
DIVLTQSPATLSVTPGDRVSLSCRASQSVSNYLHWYQQKSHESPRLLIKYASQSISGIPS
RFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPLTFGAGTKLELRRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>7C6A_2 IgG heavy chain (chains H)
QIQLQQSGPELVKPGASVKISCKASGYTFTDFYINWMKQRPGQGLEWIGWIFPGSGNTHY
NEKFKGKATLIVDTSSSTAFMQLNSLTSEDSAVYFCTRPVSYYYDFDYWGQGTTLTVSSA
KTTAPSVYPLAPVCGDTSGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIK

Sequence of entity 3 (A), FASTA

>7C6A_3 Type-2 angiotensin II receptor,Soluble cytochrome b562,Type-2 angiotensin II receptor (chains A)
GCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLV
LATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIWFITCMSVDRYQSVIYPFLSQ
RRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIAL
MKNILGFIIPLIFIATCYFGIRKHLLKTNADLEDNWETLNDNLKVIEKADNAAQVKDALT
KMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAA
EQLKTTRNAYIQKYLKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSC
EVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESENLY
FQ

Sequence of entity 4 (B), FASTA

>7C6A_4 SAR1, ILE8-ANGIOTENSIN II (chains B)
GRVYIHPI

Primary citation

The discovery of a new antibody for BRIL-fused GPCR structure determination. Miyagi, H., Asada, H., Suzuki, M. et al. Sci Rep (2020) 10:11669-11669. DOI 10.1038/s41598-020-68355-x · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 7C6A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.