7C7S: PDB entry 7C7S

Cryo-EM structure of the CGP54626-bound human GABA(B) receptor in inactive state. Determined by electron microscopy at 2.9 Å resolution. Released 1 Jul 2020.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 10,915
Mol. weight: 199.51 kDa
Ligands: 2BV, NAG
Released: 1 Jul 2020

Explore 7C7S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7C7S contains 54 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	168-175	8	1
α-helix	185-200	16
β-strand	209-216	8	1
α-helix	222-233	12
α-helix	238	1
β-strand	239-243	5	1
α-helix	247-256	10
β-strand	263-266	4	1
α-helix	272-275	4
β-strand	283-285	3	1
α-helix	288-289	2
α-helix	290-292	3
α-helix	293-303	11
β-strand	308-314	7	2
α-helix	317-331	15
β-strand	336-343	8	2
α-helix	348-357	10
β-strand	361-363	3	2
β-strand	365	1	2
α-helix	368-381	14
β-strand	389-393	5	2
β-strand	423-427	5	2
α-helix	443-451	9
α-helix	464-466	3
α-helix	467-484	18
α-helix	504-514	11
β-strand	518-520	3	3
β-strand	523-525	3	3
β-strand	527	1	4
β-strand	532	1	1
β-strand	533	1	4
α-helix	534	1
β-strand	536-542	7	2
β-strand	547-554	8	2
β-strand	559-562	4	2
α-helix	573-575	3
β-strand	580-584	5	5
α-helix	589-615	27
α-helix	627-648	22
α-helix	659-692	34
α-helix	707-731	25
β-strand	735-740	6	5
β-strand	744	1	5
β-strand	753-762	10	5
α-helix	766-790	25
α-helix	802-825	24
α-helix	830-858	29

Chain B: 30 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	55-62	8	6
α-helix	71-76	6
α-helix	78-91	14
β-strand	98-105	8	6
α-helix	110-122	13
β-strand	127-132	6	6
α-helix	136-149	14
β-strand	152-155	4	6
α-helix	161-164	4
β-strand	172-174	3	6
α-helix	177-178	2
α-helix	179-182	4
α-helix	183-193	11
β-strand	197-203	7	7
α-helix	206-218	13
β-strand	225-232	8	7
α-helix	239-241	3
β-strand	250-253	4	7
α-helix	257-270	14
β-strand	278-282	5	7
α-helix	286	1
α-helix	304-311	8
α-helix	314	1
β-strand	315-319	5	7
α-helix	335-345	11
α-helix	350-351	2
α-helix	355-373	19
α-helix	393-403	11
β-strand	407-410	4	8
β-strand	413-416	4	8
β-strand	417-418	2	9
β-strand	421-422	2	9
β-strand	425-433	9	7
β-strand	435-443	9	7
β-strand	448-451	4	7
α-helix	463-465	3
β-strand	470-471	2	10
α-helix	474-478	5
α-helix	479-505	27
α-helix	510-513	4
α-helix	517-538	22
α-helix	546-550	5
α-helix	553-583	31
α-helix	599-618	20
β-strand	622-627	6	11
β-strand	640-641	2	10
β-strand	644-649	6	11
α-helix	653-677	25
α-helix	690-712	23
α-helix	717-740	24
α-helix	742-748	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid type B receptor subunit 1	A	protein	937	Homo sapiens	Q9UBS5 (AlphaFold model)
Gamma-aminobutyric acid type B receptor subunit 2	B	protein	808	Homo sapiens	O75899 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7C7S_1 Gamma-aminobutyric acid type B receptor subunit 1 (chains A)
MKTIIALSYIFCLVFAPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLP
VDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGD
LPALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTPHSERRAVYIGALFPM
SGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPI
KIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRV
KLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQD
ARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEA
VEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALA
LALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTL
IEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVL
SSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRNQ
FPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLV
GMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKG
LLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFAS
LAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENREL
EKIIAEKEERVSELRHQLQSRLEVLFQGPHHHHHHHH

Sequence of entity 2 (B), FASTA

>7C7S_2 Gamma-aminobutyric acid type B receptor subunit 2 (chains B)
MKTIIALSYIFCLVFADYKDDDDKGSGGSGWARGAPRPPPSSPPLSIMGLMPLTKEVAKG
SIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVF
GGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLK
HYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRII
LGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAM
EGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQR
AMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQF
QDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTIL
GMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDGSFVSEKTFET
LCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVIVGGMLLIDLCI
LICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFG
CFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQFCIVALVIIFC
STITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSVNQASTSRLEGL
QSENHRLRMKITELDKDLEEVTMQLQDT

Ligands and cofactors

ID	Name	Formula	Copies
2BV	(R)-(cyclohexylmethyl)[(2S)-3-{[(1S)-1-(3,4-dichlorophenyl)ethyl]amino}-2-hydro…	C18 H28 Cl2 N O3 P	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	8

Primary citation

Cryo-EM structures of inactive and active GABABreceptor. Mao, C., Shen, C., Li, C. et al. Cell Res (2020) 30:564-573. DOI 10.1038/s41422-020-0350-5 · PubMed

Other PDB entries of the same protein (UniProt Q9UBS5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PAS 1.62 Å, Heterodimeric coiled-coil structure of human GABA(B) receptor
4MS4 1.9 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MR7 2.15 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MR8 2.15 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MQF 2.22 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MS1 2.25 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MQE 2.35 Å, Crystal structure of the extracellular domain of human GABA(B) receptor in the apo form
4MR9 2.35 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MS3 2.5 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MRM 2.86 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
7C7Q 3.0 Å, Cryo-EM structure of the baclofen/BHFF-bound human GABA(B) receptor in active state
6W2Y 3.2 Å, CryoEM Structure of GABAB1b Homodimer

Browse structure collections

About this viewer

MolViewer shows 7C7S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.