7C7Q: PDB entry 7C7Q

Cryo-EM structure of the baclofen/BHFF-bound human GABA(B) receptor in active state. Determined by electron microscopy at 3.0 Å resolution. Released 1 Jul 2020.

Method: Electron microscopy
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 10,894
Mol. weight: 188.21 kDa
Ligands: 2C0, FN0, NAG
Released: 1 Jul 2020

Explore 7C7Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7C7Q contains 57 α-helices and 39 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	168-175	8	1
α-helix	185-201	17
β-strand	209-216	8	1
α-helix	222-233	12
α-helix	238	1
β-strand	239-244	6	1
α-helix	247-256	10
α-helix	257-259	3
β-strand	263-266	4	1
α-helix	272-275	4
β-strand	283-285	3	1
α-helix	288-289	2
α-helix	290-292	3
α-helix	293-303	11
β-strand	308-314	7	2
α-helix	317-333	17
β-strand	336-343	8	2
α-helix	348-356	9
β-strand	361-365	5	2
α-helix	368-381	14
β-strand	389-393	5	2
α-helix	412-418	7
β-strand	423-427	5	2
α-helix	443-453	11
α-helix	458-460	3
α-helix	467-483	17
α-helix	504-514	11
β-strand	517-520	4	3
β-strand	523-526	4	3
β-strand	536-542	7	2
β-strand	547-554	8	2
β-strand	559-562	4	2
α-helix	573-575	3
β-strand	580-584	5	4
α-helix	589-615	27
α-helix	621-624	4
α-helix	627-642	16
α-helix	644-648	5
α-helix	660-678	19
α-helix	683-691	9
α-helix	709-731	23
β-strand	735-740	6	4
β-strand	753-762	10	4
α-helix	769-790	22
α-helix	802-825	24
α-helix	830-860	31

Chain B: 29 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	56-62	7	5
α-helix	71-91	21
β-strand	99-105	7	5
α-helix	110-123	14
β-strand	127-132	6	5
α-helix	136-144	9
α-helix	146-148	3
β-strand	152-155	4	5
α-helix	161-164	4
β-strand	172-174	3	5
α-helix	179-182	4
α-helix	183-191	9
β-strand	197-203	7	6
α-helix	206-218	13
β-strand	225-232	8	6
α-helix	240-245	6
β-strand	250-254	5	6
α-helix	257-267	11
β-strand	278-280	3	6
β-strand	282	1	7
α-helix	286	1
α-helix	289-291	3
α-helix	304-311	8
β-strand	315-319	5	7
α-helix	335-345	11
α-helix	349-352	4
α-helix	355-375	21
α-helix	393-404	12
β-strand	407-410	4	8
β-strand	413-416	4	8
β-strand	417-418	2	9
β-strand	421-422	2	9
β-strand	425-432	8	7
β-strand	435-443	9	7
β-strand	448-451	4	7
α-helix	452	1
α-helix	463-465	3
β-strand	470-474	5	10
α-helix	476-478	3
α-helix	479-505	27
α-helix	510-513	4
α-helix	517-531	15
α-helix	532-537	6
α-helix	546-582	37
α-helix	596-618	23
β-strand	623-627	5	10
β-strand	640-648	9	10
α-helix	653-679	27
α-helix	689-710	22
α-helix	717-747	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid type B receptor subunit 1	A	protein	879	Homo sapiens	Q9UBS5 (AlphaFold model)
Gamma-aminobutyric acid type B receptor subunit 2	B	protein	769	Homo sapiens	O75899 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7C7Q_1 Gamma-aminobutyric acid type B receptor subunit 1 (chains A)
MKTIIALSYIFCLVFAPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLP
VDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGD
LPALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTPHSERRAVYIGALFPM
SGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPI
KIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRV
KLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQD
ARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEA
VEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALA
LALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTL
IEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVL
SSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRNQ
FPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLV
GMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKG
LLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFAS
LAIVFSSYITLVVLFVPKMRRLITEVLFQGPHHHHHHHH

Sequence of entity 2 (B), FASTA

>7C7Q_2 Gamma-aminobutyric acid type B receptor subunit 2 (chains B)
MKTIIALSYIFCLVFADYKDDDDKGSGGSGWARGAPRPPPSSPPLSIMGLMPLTKEVAKG
SIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVF
GGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLK
HYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRII
LGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAM
EGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQR
AMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQF
QDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTIL
GMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDGSFVSEKTFET
LCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVIVGGMLLIDLCI
LICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFG
CFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQFCIVALVIIFC
STITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSV

Ligands and cofactors

ID	Name	Formula	Copies
2C0	baclofen	C10 H12 Cl N O2	1
FN0	(3S)-5,7-ditert-butyl-3-oxidanyl-3-(trifluoromethyl)-1-benzofuran-2-one	C17 H21 F3 O3	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	8

Primary citation

Cryo-EM structures of inactive and active GABABreceptor. Mao, C., Shen, C., Li, C. et al. Cell Res (2020) 30:564-573. DOI 10.1038/s41422-020-0350-5 · PubMed

Other PDB entries of the same protein (UniProt Q9UBS5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PAS 1.62 Å, Heterodimeric coiled-coil structure of human GABA(B) receptor
4MS4 1.9 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MR7 2.15 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MR8 2.15 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MQF 2.22 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MS1 2.25 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MQE 2.35 Å, Crystal structure of the extracellular domain of human GABA(B) receptor in the apo form
4MR9 2.35 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MS3 2.5 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MRM 2.86 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
7C7S 2.9 Å, Cryo-EM structure of the CGP54626-bound human GABA(B) receptor in inactive state.
6W2Y 3.2 Å, CryoEM Structure of GABAB1b Homodimer

Browse more

7C7Q is part of these collections:

About this viewer

MolViewer shows 7C7Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.