7CEA: HUTS-4 Fv-clasp fragment

Crystal structure of HUTS-4 Fv-clasp fragment. Determined by X-ray diffraction at 2.55 Å resolution. Released 23 Jun 2021.

Method: X-ray diffraction
Resolution: 2.55 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 2,565
Mol. weight: 37.46 kDa
Released: 23 Jun 2021

Explore 7CEA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CEA contains 7 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	11-12	2	2
β-strand	18-25	8	1
β-strand	32-39	8	3
β-strand	46-52	7	3
β-strand	57-59	3	3
β-strand	67-72	6	1
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	89-96	8	3
β-strand	100D-103	4	3
β-strand	107-108	2	3
β-strand	110-111	2	2
α-helix	118-122	5
α-helix	125-163	39

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	4
β-strand	10-13	4	5
β-strand	19-25	7	4
β-strand	34-38	5	5
β-strand	45-49	5	5
β-strand	53-54	2	5
α-helix	55	1
β-strand	62-67	6	4
β-strand	70-75	6	4
α-helix	80-82	3
β-strand	85-90	6	5
α-helix	96	1
β-strand	97-98	2	5
β-strand	102-106	5	5
α-helix	120-157	38

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Huts-4 VH(S112C)-sarah	A	protein	174	Mus musculus, Homo sapiens	Q13043 (AlphaFold model)
Huts-4 VL(C87Y)-SARAH(S37C)	B	protein	159	Mus musculus, Homo sapiens	Q13043 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7CEA_1 HUTS-4 VH(S112C)-SARAH (chains A)
MQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDK
RYHPSLKSRLTISKDTSSNQVFLKITSVDTADTATYYCARSIYDGYYDYFDVWGAGTTVT
VCSGSDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK

Sequence of entity 2 (B), FASTA

>7CEA_2 HUTS-4 VL(C87Y)-SARAH(S37C) (chains B)
MQIVLSQSPAILSASPGEKVTMTCRATSSVTYMHWYQQKPGSSPKPWIYATSNLASGVPA
RFSGSGSGTSYSLTISRVEAADAATYYCQQWTSNPPTFGGGTKLEIKRGSDYEFLKSWTV
EDLQKRLLALDPMMEQEIEEIRQKYQCKRQPILDAIEAK

Primary citation

Structural mechanism of laminin recognition by integrin. Arimori, T., Miyazaki, N., Mihara, E. et al. Nat Commun (2021) 12:4012-4012. DOI 10.1038/s41467-021-24184-8 · PubMed

Other PDB entries of the same protein (UniProt Q13043 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PAV 1.9 Å, Crystal structure of MST1 with a MAP4K1 SMOL inhibitor
4NR2 2.0 Å, Crystal structure of STK4 (MST1) SARAH domain
8A5J 2.12 Å, Crystal structure of Human STE20-like kinase 1, MST1 in complex with compound XMU-MP-1
8PAW 2.14 Å, Crystal structure of MST1 with a MAP4K1 SMOL inhibitor
3COM 2.2 Å, Crystal structure of Mst1 kinase
4OH8 2.28 Å, Crystal Structure of the human MST1-RASSF5 SARAH heterodimer
5TWG 2.3 Å, human MOB1A bound to human MST1 phosphorylated T353 peptide
9VX3 2.39 Å, Crystal structure of the peptide-bound form of HisMab-1 Fv-clasp
5TWH 2.5 Å, human MOB1A bound to MST1 phosphorylated T367 peptide
6YAT 2.58 Å, Crystal structure of STK4 (MST1) in complex with compound 6
9IIC 2.78 Å, Crystal structure of HOIP RING2-LDD in complex with STK4 KD domain
7CEB 2.89 Å, Crystal structure of alpha6beta1 integrin headpiece

Browse structure collections

About this viewer

MolViewer shows 7CEA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.