7COW: Histone H3.1
353 bp di-nucleosome harboring cohesive DNA termini with linker histone H1.0. Determined by X-ray diffraction at 2.86 Å resolution. Released 11 Aug 2021.
- Method
- X-ray diffraction
- Resolution
- 2.86 Å
- Organisms
- other sequences, Homo sapiens
- Chains
- 20
- Atoms
- 27,785
- Mol. weight
- 483.73 kDa
- Ligands
- CA
- Released
- 11 Aug 2021
Explore 7COW in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7COW contains 79 α-helices and 44 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 45-56 | 12 | |
| α-helix | 64-78 | 15 | |
| β-strand | 83-84 | 2 | 1 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 2 |
| α-helix | 121-131 | 11 | |
Chain B: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-28 | 4 | |
| α-helix | 31-41 | 11 | |
| β-strand | 45-46 | 2 | 2 |
| α-helix | 50-76 | 27 | |
| β-strand | 80-81 | 2 | 1 |
| α-helix | 83-92 | 10 | |
| β-strand | 96-98 | 3 | 3 |
Chain C: 6 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-21 | 5 | |
| α-helix | 27-37 | 11 | |
| β-strand | 42-43 | 2 | 4 |
| α-helix | 47-72 | 26 | |
| β-strand | 77-78 | 2 | 5 |
| α-helix | 80-89 | 10 | |
| α-helix | 91-97 | 7 | |
| β-strand | 100-102 | 3 | 6 |
| α-helix | 113-115 | 3 | |
Chain D: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-48 | 11 | |
| β-strand | 53-54 | 2 | 5 |
| α-helix | 56-83 | 28 | |
| β-strand | 88-89 | 2 | 4 |
| α-helix | 91-101 | 11 | |
| α-helix | 104-124 | 21 | |
Chain E: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 46-56 | 11 | |
| α-helix | 64-76 | 13 | |
| β-strand | 83-84 | 2 | 7 |
| α-helix | 86-111 | 26 | |
| α-helix | 112-114 | 3 | |
| β-strand | 118-119 | 2 | 8 |
| α-helix | 121-131 | 11 | |
Chain F: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-28 | 3 | |
| α-helix | 31-41 | 11 | |
| β-strand | 45-46 | 2 | 8 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 7 |
| α-helix | 83-92 | 10 | |
| β-strand | 96-98 | 3 | 6 |
Chain G: 6 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-21 | 5 | |
| α-helix | 27-35 | 9 | |
| β-strand | 42-43 | 2 | 9 |
| α-helix | 47-72 | 26 | |
| β-strand | 77-78 | 2 | 10 |
| α-helix | 80-89 | 10 | |
| α-helix | 91-96 | 6 | |
| β-strand | 100-102 | 3 | 3 |
| α-helix | 113-115 | 3 | |
Chain H: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-48 | 11 | |
| β-strand | 53-54 | 2 | 10 |
| α-helix | 56-83 | 28 | |
| β-strand | 88-89 | 2 | 9 |
| α-helix | 92-101 | 10 | |
| α-helix | 104-122 | 19 | |
10 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA (353-mer) | I | DNA | 353 | other sequences | |
| DNA (353-mer) | J | DNA | 353 | other sequences | |
| Histone H3.1 | A, E, K, O | protein | 138 | Homo sapiens | P68431 (AlphaFold model) |
| Histone H4 | B, F, L, P | protein | 105 | Homo sapiens | P62805 (AlphaFold model) |
| Histone H2A type 1-B/E | C, G, M, Q | protein | 132 | Homo sapiens | P04908 (AlphaFold model) |
| Histone H2B type 1-J | D, H, N, R | protein | 128 | Homo sapiens | P06899 (AlphaFold model) |
| Histone H1.0 | S, T | protein | 195 | Homo sapiens | P07305 |
Sequence of entity 1 (I), FASTA
>7COW_1 DNA (353-MER) (chains I)
CGCTGCGAAAAAAAAAACGCATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTC
TAGCACCGCTTAAACGCACGTACGCGCTGTCTACCGCGTTTTAACCGCCACTAGAAGCGC
TTACTAGTCTCCAGGCACGTGTGAGACCGGCACATGAAAAAAAAAATGCATGCTCGAGTA
TGAAAAAAAAAATCGCATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGC
ACCGCTTAAACGCACGTACGCGCTGTCTACCGCGTTTTAACCGCCACTAGAAGCGCTTAC
TAGTCTCCAGGCACGTGTGAGACCGGCACATGAAAAAAAAAACGCAGCGGTAC
Sequence of entity 2 (J), FASTA
>7COW_2 DNA (353-MER) (chains J)
CGCTGCGTTTTTTTTTTCATGTGCCGGTCTCACACGTGCCTGGAGACTAGTAAGCGCTTC
TAGTGGCGGTTAAAACGCGGTAGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGT
CTACGACCAATTGAGCGGCCTCGGCACCGGGATGCGATTTTTTTTTTCATACTCGAGCAT
GCATTTTTTTTTTCATGTGCCGGTCTCACACGTGCCTGGAGACTAGTAAGCGCTTCTAGT
GGCGGTTAAAACGCGGTAGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTAC
GACCAATTGAGCGGCCTCGGCACCGGGATGCGTTTTTTTTTTCGCAGCGGTAC
Sequence of entity 3 (A, E, K, O), FASTA
>7COW_3 Histone H3.1 (chains A, E, K, O)
SHMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS
TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRV
TIMPKDIQLARRIRGERA
Sequence of entity 4 (B, F, L, P), FASTA
>7COW_4 Histone H4 (chains B, F, L, P)
SHMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV
LKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sequence of entity 5 (C, G, M, Q), FASTA
>7COW_5 Histone H2A type 1-B/E (chains C, G, M, Q)
SHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEY
LTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLP
KKTESHHKAKGK
Sequence of entity 6 (D, H, N, R), FASTA
>7COW_6 Histone H2B type 1-J (chains D, H, N, R)
SHMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSK
AMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKA
VTKYTSAK
Sequence of entity 7 (S, T), FASTA
>7COW_7 Histone H1.0 (chains S, T)
GPTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYK
VGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVAT
PKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPV
KPKAKSSAKRAGKKK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CA | Calcium ion | Ca | 3 |
Water and common crystallization additives (K, CL) are not listed.
Primary citation
Engineering nucleosomes for generating diverse chromatin assemblies. Adhireksan, Z., Sharma, D., Lee, P.L. et al. Nucleic Acids Res (2021) 49:e52-e52. DOI 10.1093/nar/gkab070 · PubMed
Other PDB entries of the same protein (UniProt P68431 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5SVY 1.05 Å, MORC3 CW in complex with histone H3K4me1
- 2V89 1.1 Å, Crystal structure of RAG2-PHD finger in complex with H3K4me3 peptide at 1.1A resolution
- 5SZC 1.19 Å, Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with…
- 5SZB 1.2 Å, Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with…
- 6BHD 1.25 Å, Crystal structure of SETDB1 with a modified H3 peptide
- 4UP0 1.28 Å, Ternary crystal structure of the Pygo2 PHD finger in complex with the B9L HD1 domain and…
- 5WXH 1.3 Å, Crystal structure of TAF3 PHD finger bound to H3K4me3
- 5FFV 1.3 Å, Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone…
- 4L7X 1.35 Å, Crystal structure of the DIDO PHD finger in complex with H3K4me3
- 6BHE 1.35 Å, Crystal structure of SETDB1 with a modified H3 peptide
- 6BHI 1.4 Å, Crystal structure of SETDB1 with a modified H3 peptide
- 3ASL 1.41 Å, Structure of UHRF1 in complex with histone tail
Browse structure collections
About this viewer
MolViewer shows 7COW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.