7CQV: Complex of TRP_CBS1 and Calmodulin_Nlobe

Complex of TRP_CBS1 and Calmodulin_Nlobe. Determined by X-ray diffraction at 1.78 Å resolution. Released 23 Jun 2021.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Drosophila melanogaster
Chains: 3
Atoms: 1,521
Mol. weight: 27.25 kDa
Ligands: CA
Released: 23 Jun 2021

Explore 7CQV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CQV contains 13 α-helices and 4 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	0-2	3
α-helix	7-20	14
β-strand	27-28	2	2
α-helix	30-39	10
α-helix	46-56	11
β-strand	64-65	2	2
α-helix	66-76	11

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	20-31	12
α-helix	35-44	10
α-helix	54-62	9

Chain E: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	7-20	14
β-strand	27-28	2	1
α-helix	30-39	10
α-helix	46-56	11
β-strand	64-65	2	1
α-helix	66-75	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AT15141p	A, E	protein	80	Drosophila melanogaster	C6SUZ2 (AlphaFold model)
Transient receptor potential protein	B	protein	82	Drosophila melanogaster	P19334 (AlphaFold model)

Sequence of entity 1 (A, E), FASTA

>7CQV_1 AT15141p (chains A, E)
GPMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA
DGNGTIDFPEFLTMMARKMK

Sequence of entity 2 (B), FASTA

>7CQV_2 Transient receptor potential protein (chains B)
GPNNNWDVPDIEKKSQGVARTTKGKVMERRILKDFQIGFVENLKQEMSESESGRDIFSSL
AKVIGRKKTQKGDKDWNAIARK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

Calmodulin binds to Drosophila TRP with an unexpected mode. Chen, W., Shen, Z., Asteriti, S. et al. Structure (2021) 29:330-344.e4. DOI 10.1016/j.str.2020.11.016 · PubMed

Other PDB entries of the same protein (UniProt C6SUZ2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8JFY 2.79 Å, Cryo-EM structure of RDGC/Ca2+-CaM complex
8JFW 3.64 Å, Cryo-EM structure of RDGC/apo-CaM complex

Browse structure collections

About this viewer

MolViewer shows 7CQV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.