7CT1: Snx27 FERM domain

Crystal structure of Snx27 FERM domain in complex with a DLF motif. Determined by X-ray diffraction at 1.95 Å resolution. Released 25 Aug 2021.

Method: X-ray diffraction
Resolution: 1.95 Å
Organisms: Homo sapiens, synthetic construct
Chains: 1
Atoms: 2,354
Mol. weight: 33.56 kDa
Released: 25 Aug 2021

Explore 7CT1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CT1 contains 13 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	275-280	6	1
β-strand	286-291	6	1
α-helix	297-308	12
α-helix	315-317	3
β-strand	318-325	8	1
β-strand	328-331	4	1
α-helix	332-333	2
α-helix	338-344	7
α-helix	346-349	4
β-strand	355-359	5	1
α-helix	364-368	5
α-helix	374-389	16
β-strand	394	1	2
α-helix	399-407	9
α-helix	411-418	8
β-strand	422	1	2
β-strand	427-428	2	3
α-helix	429-431	3
β-strand	432	1	3
β-strand	434	1	4
β-strand	441-446	6	3
β-strand	451-456	6	3
β-strand	462-469	8	3
α-helix	471-473	3
β-strand	474-480	7	4
β-strand	485-490	6	4
α-helix	496-497	2
β-strand	498-502	5	4
α-helix	507-527	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion protein Sorting nexin-27 and DLF motif	A	protein	286	Homo sapiens, synthetic construct	Q96L92 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7CT1_1 Fusion protein Sorting nexin-27 and DLF motif (chains A)
SDVELRVALPDGTTVTVRVKKNSTTDQVYQAIAAKVGMDSTTVNYFALFEVISHSFVRKL
APNEFPHKLYIQNYTSAVPGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDDVKKGY
IKAEEKSYQLQKLYEQRKMVMYLNMLRTCEGYNEIIFPHCACDSRRKGHVITAISITHFK
LHACTEEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEYARGEKKPRWVKIFTPYFNYMHE
CFERVFCELKWRKEEYGGSGGSPINNGSKENGIHEEQDQEPQDLFA

Primary citation

Crystal structure of Snx27 FERM domain in complex with a DLF motif. Hu, W., Jia, D., Sun, Q. To be published.

Other PDB entries of the same protein (UniProt Q96L92 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7E0B 1.29 Å, The crystal structure of sorting nexin 27 and PBM complex
4HAS 1.74 Å, Crystal structure of PX domain of human sorting nexin SNX27
5ZN9 1.78 Å, Crystal structure of PX domain
6SAK 2.0 Å, Structure of the OTULINcat C129A - SNX27 PDZ domain complex.
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2
8TTV 2.0 Å, Structure of SNX27 FERM complexed with Fam21A repeat 20 (1289-1302)
7P72 2.15 Å, The PDZ domain of SNX27 complexed with the PDZ-binding motif of MERS-E
8TTT 2.35 Å, Structure of SNX27 FERM complexed with Fam21A repeat 15 (1124-1140)
8TTU 2.36 Å, Structure of SNX27 FERM complexed with Fam21A repeat 19 (1261 - 1274)

Browse structure collections

About this viewer

MolViewer shows 7CT1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.