8TTU: SNX27 FERM

Structure of SNX27 FERM complexed with Fam21A repeat 19 (1261 - 1274). Determined by X-ray diffraction at 2.36 Å resolution. Released 21 Aug 2024.

Method: X-ray diffraction
Resolution: 2.36 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,246
Mol. weight: 32.97 kDa
Released: 21 Aug 2024

Explore 8TTU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TTU contains 12 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	274-280	7	1
β-strand	286-292	7	1
α-helix	297-307	11
α-helix	314-317	4
β-strand	318-325	8	1
β-strand	328-331	4	1
α-helix	332-333	2
α-helix	338-344	7
β-strand	355-359	5	1
α-helix	364-368	5
α-helix	374-390	17
α-helix	396-398	3
α-helix	399-407	9
α-helix	411-418	8
β-strand	427-428	2	2
β-strand	432	1	2
β-strand	434	1	3
β-strand	441-446	6	2
β-strand	451-456	6	2
β-strand	462-469	8	2
α-helix	470	1
α-helix	471-473	3
β-strand	474-480	7	3
β-strand	485-490	6	3
β-strand	498-502	5	3
α-helix	507-522	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-27	A	protein	261	Homo sapiens	Q96L92 (AlphaFold model)
Fam21A repeat 19 peptide	B	protein	14	Homo sapiens	Q641Q2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8TTU_1 Sorting nexin-27 (chains A)
SNAGVSDVELRVALPDGTTVTVRVKKNSTTDQVYQAIAAKVGMDSTTVNYFALFEVISHS
FVRKLAPNEFPHKLYIQNYTSAVPGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDD
VKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRTCEGYNEIIFPHCACDSRRKGHVITAIS
ITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEYARGEKKPRWVKIFTPYF
NYMHECFERVFCELKWRKEEY

Sequence of entity 2 (B), FASTA

>8TTU_2 Fam21A repeat 19 peptide (chains B)
NLFDDNIDIFADLT

Primary citation

Structural basis for coupling of the WASH subunit FAM21 with the endosomal SNX27-Retromer complex. Guo, Q., Chen, K.E., Gimenez-Andres, M. et al. Proc Natl Acad Sci U S A (2024) 121:e2405041121-e2405041121. DOI 10.1073/pnas.2405041121 · PubMed

Other PDB entries of the same protein (UniProt Q96L92 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7E0B 1.29 Å, The crystal structure of sorting nexin 27 and PBM complex
4HAS 1.74 Å, Crystal structure of PX domain of human sorting nexin SNX27
5ZN9 1.78 Å, Crystal structure of PX domain
7CT1 1.95 Å, Crystal structure of Snx27 FERM domain in complex with a DLF motif
6SAK 2.0 Å, Structure of the OTULINcat C129A - SNX27 PDZ domain complex.
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2
8TTV 2.0 Å, Structure of SNX27 FERM complexed with Fam21A repeat 20 (1289-1302)
7P72 2.15 Å, The PDZ domain of SNX27 complexed with the PDZ-binding motif of MERS-E
8TTT 2.35 Å, Structure of SNX27 FERM complexed with Fam21A repeat 15 (1124-1140)

Browse structure collections

About this viewer

MolViewer shows 8TTU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.