7D0E: FIP200 Claw/p-CCPG1 FIR2

Crystal structure of FIP200 Claw/p-CCPG1 FIR2. Determined by X-ray diffraction at 1.4 Å resolution. Released 31 Mar 2021.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,087
Mol. weight: 13.95 kDa
Ligands: GO9
Released: 31 Mar 2021

Explore 7D0E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7D0E contains 3 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	1506-1512	7	1
β-strand	1517-1520	4	1
β-strand	1528-1530	3	1
α-helix	1531	1
α-helix	1532-1534	3
α-helix	1536-1538	3
β-strand	1554-1567	14	1
β-strand	1581-1589	9	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	106-110	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RB1-inducible coiled-coil protein 1	A	protein	105	Homo sapiens	Q8TDY2 (AlphaFold model)
Cell cycle progression protein 1 FIR2	B	protein	13	Homo sapiens	Q9ULG6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7D0E_1 RB1-inducible coiled-coil protein 1 (chains A)
SRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGA
SRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV

Sequence of entity 2 (B), FASTA

>7D0E_2 Cell cycle progression protein 1 FIR2 (chains B)
SDDSDIVTLEPPK

Ligands and cofactors

ID	Name	Formula	Copies
GO9	3-(2-hydroxyethyloxy)-2-[2-(2-hydroxyethyloxy)ethoxymethyl]-2-(2-hydroxyethylox…	C13 H28 O8	1

Water and common crystallization additives (PEG) are not listed.

Primary citation

Phosphorylation regulates the binding of autophagy receptors to FIP200 Claw domain for selective autophagy initiation. Zhou, Z., Liu, J., Fu, T. et al. Nat Commun (2021) 12:1570-1570. DOI 10.1038/s41467-021-21874-1 · PubMed

Other PDB entries of the same protein (UniProt Q8TDY2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9D34 1.42 Å, FIP200 C-terminal CLAW domain (resid. 1490-1594) in complex with phosphorylated TNIP1…
8YFL 1.5 Å, crystal structure of FIP200 claw/TNIP1_FIR_pS122pS123
8YFM 1.5 Å, Crystal structure of FIP200 claw/TNIP1_FIR_pS122
6DCE 1.56 Å, X-ray structure of FIP200 claw domain
9J54 1.61 Å, Crystal structure of FIP200 Claw in complex with ATG16L1
7CZG 1.8 Å, Crystal structure of FIP200 Claw domain apo form
9LUA 1.97 Å, Crystal structure of FIP200 Claw domain and SMCR8 FIR motif complex
7CZM 2.0 Å, Crystal structure of FIP200 Claw/p-OPtineurin LIR complex
8YFK 2.0 Å, Crystal structure of FIP200 claw/TNIP1_FIR_pS123
7EA2 2.14 Å, crystal structure of NAP1 FIR in complex with RB1CC1 Claw domain
8YFN 2.3 Å, Crystal structure of FIP200 claw in complex with TNIP1_FIR_pS123 peptide with an…
8W6B 2.39 Å, crystal structure of TAX1BP1 SKICH domain in complex with RB1CC1 coiled-coil domain

Browse structure collections

About this viewer

MolViewer shows 7D0E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.