Crystal structure of mouse Cryptochrome 1 in complex with compound TH303. Determined by X-ray diffraction at 1.91 Å resolution. Released 27 Jan 2021.
Explore 7D1C in 3D Show helices and sheets RCSB PDB PDBe
7D1C contains 35 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-9 | 6 | 1 |
| α-helix | 19-25 | 7 | |
| β-strand | 30-37 | 8 | 1 |
| α-helix | 42-44 | 3 | |
| α-helix | 49-67 | 19 | |
| β-strand | 73-77 | 5 | 1 |
| α-helix | 80-91 | 12 | |
| β-strand | 95-99 | 5 | 1 |
| α-helix | 104-119 | 16 | |
| β-strand | 123-127 | 5 | 1 |
| α-helix | 135-141 | 7 | |
| α-helix | 150-158 | 9 | |
| α-helix | 161-169 | 9 | |
| α-helix | 172-175 | 4 | |
| β-strand | 179 | 1 | 1 |
| α-helix | 186-190 | 5 | |
| α-helix | 191-194 | 4 | |
| α-helix | 196-198 | 3 | |
| α-helix | 214-229 | 16 | |
| α-helix | 241-244 | 4 | |
| α-helix | 246-247 | 2 | |
| α-helix | 252-257 | 6 | |
| α-helix | 262-277 | 16 | |
| α-helix | 284-287 | 4 | |
| α-helix | 290-300 | 11 | |
| β-strand | 315 | 1 | 2 |
| β-strand | 321 | 1 | 3 |
| α-helix | 324-331 | 8 | |
| α-helix | 338-350 | 13 | |
| α-helix | 355-363 | 9 | |
| α-helix | 364-368 | 5 | |
| β-strand | 372 | 1 | 3 |
| α-helix | 374-384 | 11 | |
| α-helix | 390-400 | 11 | |
| β-strand | 404 | 1 | 2 |
| α-helix | 411-414 | 4 | |
| α-helix | 417-422 | 6 | |
| α-helix | 427-432 | 6 | |
| α-helix | 434-436 | 3 | |
| α-helix | 441-444 | 4 | |
| α-helix | 447-449 | 3 | |
| α-helix | 452-457 | 6 | |
| β-strand | 462 | 1 | 4 |
| β-strand | 466 | 1 | 4 |
| α-helix | 467-469 | 3 | |
| α-helix | 473-489 | 17 | |
| α-helix | 491-494 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cryptochrome-1 | A | protein | 498 | Mus musculus | P97784 (AlphaFold model) |
>7D1C_1 Cryptochrome-1 (chains A) GTMGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQC LEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLAT EAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKC MTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPR MNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYT AATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLAR HAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGF GRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASR LNIERMKQIYQQLSRYRG
| ID | Name | Formula | Copies |
|---|---|---|---|
| GOF | N-[2-(4-methoxyphenyl)-5,5-bis(oxidanylidene)-4,6-dihydrothieno[3,4-c]pyrazol-3… | C26 H21 N3 O5 S | 1 |
Photopharmacological Manipulation of Mammalian CRY1 for Regulation of the Circadian Clock. Kolarski, D., Miller, S., Oshima, T. et al. J Am Chem Soc (2021) 143:2078-2087. DOI 10.1021/jacs.0c12280 · PubMed
Other PDB entries of the same protein (UniProt P97784 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7D1C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.