7D43: EIF2B-eIF2(aP), aPg complex
eIF2B-eIF2(aP), aPg complex. Determined by electron microscopy at 4.3 Å resolution. Released 9 Dec 2020.
- Method
- Electron microscopy
- Resolution
- 4.3 Å
- Organism
- Homo sapiens
- Chains
- 14
- Atoms
- 31,009
- Mol. weight
- 684.52 kDa
- Released
- 9 Dec 2020
Explore 7D43 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7D43 contains 170 α-helices and 231 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 14 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-16 | 13 | |
| α-helix | 22-35 | 14 | |
| α-helix | 46-56 | 11 | |
| α-helix | 63-76 | 14 | |
| α-helix | 88-115 | 28 | |
| α-helix | 116-118 | 3 | |
| β-strand | 125-126 | 2 | 1 |
| α-helix | 133-143 | 11 | |
| β-strand | 150-153 | 4 | 1 |
| α-helix | 160-169 | 10 | |
| β-strand | 175-178 | 4 | 1 |
| α-helix | 180-183 | 4 | |
| α-helix | 185-188 | 4 | |
| β-strand | 193-196 | 4 | 1 |
| β-strand | 200-201 | 2 | 2 |
| β-strand | 206-209 | 4 | 2 |
| α-helix | 212-219 | 8 | |
| β-strand | 226-229 | 4 | 1 |
| α-helix | 232-234 | 3 | |
| β-strand | 235-236 | 2 | 2 |
| α-helix | 248-251 | 4 | |
| β-strand | 273-276 | 4 | 2 |
| β-strand | 283 | 1 | 1 |
| β-strand | 286 | 1 | 3 |
| β-strand | 289 | 1 | 3 |
| α-helix | 294-304 | 11 | |
Chain B: 13 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-15 | 13 | |
| α-helix | 22-35 | 14 | |
| α-helix | 46-59 | 14 | |
| α-helix | 63-74 | 12 | |
| α-helix | 88-115 | 28 | |
| β-strand | 124-126 | 3 | 4 |
| α-helix | 132-143 | 12 | |
| β-strand | 149-152 | 4 | 4 |
| α-helix | 161-168 | 8 | |
| α-helix | 169-171 | 3 | |
| β-strand | 175-177 | 3 | 4 |
| α-helix | 180-182 | 3 | |
| α-helix | 183-186 | 4 | |
| β-strand | 193 | 1 | 5 |
| β-strand | 196 | 1 | 6 |
| β-strand | 200 | 1 | 7 |
| β-strand | 206 | 1 | 7 |
| β-strand | 207-209 | 3 | 8 |
| α-helix | 212-221 | 10 | |
| β-strand | 226 | 1 | 5 |
| β-strand | 227 | 1 | 9 |
| β-strand | 229 | 1 | 6 |
| α-helix | 232-234 | 3 | |
| β-strand | 235 | 1 | 7 |
| β-strand | 273-275 | 3 | 8 |
| β-strand | 283 | 1 | 9 |
| β-strand | 286 | 1 | 10 |
| β-strand | 289 | 1 | 10 |
| α-helix | 294-304 | 11 | |
Chain C: 16 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-24 | 16 | |
| α-helix | 31-47 | 17 | |
| α-helix | 54-71 | 18 | |
| α-helix | 77-95 | 19 | |
| α-helix | 129-158 | 30 | |
| β-strand | 164-167 | 4 | 11 |
| α-helix | 172-181 | 10 | |
| β-strand | 188-191 | 4 | 11 |
| α-helix | 202-209 | 8 | |
| β-strand | 214-216 | 3 | 11 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-225 | 4 | |
| α-helix | 226-228 | 3 | |
| β-strand | 232-234 | 3 | 12 |
| β-strand | 239 | 1 | 13 |
| β-strand | 246-248 | 3 | 14 |
| α-helix | 252-261 | 10 | |
| β-strand | 265-267 | 3 | 12 |
| α-helix | 271-273 | 3 | |
| β-strand | 274 | 1 | 13 |
| β-strand | 288 | 1 | 15 |
| α-helix | 302-304 | 3 | |
| β-strand | 306-308 | 3 | 16 |
| β-strand | 311 | 1 | 15 |
| β-strand | 313-315 | 3 | 14 |
| α-helix | 318-320 | 3 | |
| β-strand | 323 | 1 | 12 |
| α-helix | 335-342 | 8 | |
| α-helix | 346-348 | 3 | |
Chain D: 18 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-23 | 15 | |
| α-helix | 31-48 | 18 | |
| α-helix | 54-71 | 18 | |
| α-helix | 76-97 | 22 | |
| α-helix | 128-145 | 18 | |
| α-helix | 147-154 | 8 | |
| α-helix | 155-157 | 3 | |
| β-strand | 164-166 | 3 | 17 |
| α-helix | 172-181 | 10 | |
| β-strand | 188-193 | 6 | 17 |
| α-helix | 194 | 1 | |
| α-helix | 200-210 | 11 | |
| β-strand | 214-218 | 5 | 17 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-225 | 4 | |
| α-helix | 226-228 | 3 | |
| β-strand | 231-232 | 2 | 17 |
| β-strand | 233-234 | 2 | 18 |
| β-strand | 238-239 | 2 | 19 |
| β-strand | 245-248 | 4 | 19 |
| α-helix | 251-259 | 9 | |
| β-strand | 266-267 | 2 | 18 |
| β-strand | 274 | 1 | 19 |
| β-strand | 288 | 1 | 20 |
| α-helix | 297-299 | 3 | |
| β-strand | 306-307 | 2 | 21 |
| β-strand | 311 | 1 | 20 |
| β-strand | 313-315 | 3 | 19 |
| α-helix | 318-320 | 3 | |
| α-helix | 333-342 | 10 | |
| α-helix | 347-349 | 3 | |
Chain E: 10 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8 | 1 | 22 |
| α-helix | 37-44 | 8 | |
| β-strand | 52-54 | 3 | 22 |
| α-helix | 63-67 | 5 | |
| β-strand | 76-78 | 3 | 22 |
| α-helix | 86-93 | 8 | |
| β-strand | 103 | 1 | 23 |
| β-strand | 108 | 1 | 24 |
| α-helix | 115-121 | 7 | |
| β-strand | 129-133 | 5 | 25 |
| β-strand | 158-161 | 4 | 26 |
| β-strand | 167-169 | 3 | 26 |
| α-helix | 173-175 | 3 | |
| β-strand | 182 | 1 | 27 |
| α-helix | 184-187 | 4 | |
| β-strand | 193-196 | 4 | 26 |
| β-strand | 200 | 1 | 25 |
| β-strand | 205 | 1 | 23 |
| α-helix | 209-216 | 8 | |
| α-helix | 224-228 | 5 | |
| α-helix | 229-235 | 7 | |
| β-strand | 264-268 | 5 | 25 |
| β-strand | 273 | 1 | 24 |
| α-helix | 282-291 | 10 | |
| β-strand | 364 | 1 | 28 |
| β-strand | 379-381 | 3 | 28 |
| β-strand | 392 | 1 | 29 |
| β-strand | 396-398 | 3 | 28 |
| β-strand | 409 | 1 | 29 |
| β-strand | 413-414 | 2 | 30 |
| β-strand | 430-431 | 2 | 30 |
Chain F: 10 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7 | 1 | 31 |
| α-helix | 38-45 | 8 | |
| β-strand | 52-54 | 3 | 31 |
| α-helix | 65-68 | 4 | |
| β-strand | 76-78 | 3 | 31 |
| α-helix | 86-93 | 8 | |
| α-helix | 94-96 | 3 | |
| β-strand | 102 | 1 | 32 |
| β-strand | 108-109 | 2 | 33 |
| α-helix | 115-123 | 9 | |
| β-strand | 132-133 | 2 | 34 |
| β-strand | 158-161 | 4 | 35 |
| β-strand | 169-170 | 2 | 35 |
| α-helix | 184-189 | 6 | |
| β-strand | 192-196 | 5 | 35 |
| β-strand | 200-201 | 2 | 34 |
| β-strand | 206 | 1 | 32 |
| α-helix | 209-217 | 9 | |
| α-helix | 224-228 | 5 | |
| α-helix | 229-234 | 6 | |
| β-strand | 267-268 | 2 | 34 |
| β-strand | 272-273 | 2 | 33 |
| α-helix | 281-291 | 11 | |
| β-strand | 381 | 1 | 36 |
| β-strand | 391-392 | 2 | 37 |
| β-strand | 396-397 | 2 | 38 |
| β-strand | 398 | 1 | 36 |
| β-strand | 408-409 | 2 | 37 |
| β-strand | 413-414 | 2 | 38 |
| β-strand | 425 | 1 | 39 |
| β-strand | 426 | 1 | 37 |
| β-strand | 443 | 1 | 39 |
Chain G: 20 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 168-171 | 4 | |
| α-helix | 178-181 | 4 | |
| β-strand | 185 | 1 | 40 |
| α-helix | 192-194 | 3 | |
| α-helix | 205-215 | 11 | |
| α-helix | 222-239 | 18 | |
| α-helix | 248-266 | 19 | |
| α-helix | 268-270 | 3 | |
| α-helix | 271-284 | 14 | |
| α-helix | 293-308 | 16 | |
| α-helix | 309-313 | 5 | |
| α-helix | 315-324 | 10 | |
| β-strand | 334-335 | 2 | 16 |
| β-strand | 336 | 1 | 41 |
| α-helix | 340-351 | 12 | |
| β-strand | 359-362 | 4 | 16 |
| α-helix | 369-377 | 9 | |
| β-strand | 383-387 | 5 | 16 |
| α-helix | 388-390 | 3 | |
| α-helix | 391-394 | 4 | |
| β-strand | 401 | 1 | 42 |
| β-strand | 403 | 1 | 41 |
| β-strand | 407 | 1 | 43 |
| β-strand | 414-417 | 4 | 43 |
| α-helix | 421-430 | 10 | |
| β-strand | 434 | 1 | 42 |
| β-strand | 435-437 | 3 | 44 |
| α-helix | 440-442 | 3 | |
| β-strand | 457 | 1 | 40 |
| α-helix | 460-463 | 4 | |
| β-strand | 467 | 1 | 45 |
| β-strand | 470 | 1 | 45 |
| β-strand | 482-483 | 2 | 11 |
| β-strand | 487 | 1 | 40 |
| β-strand | 489-492 | 4 | 43 |
| β-strand | 499-502 | 4 | 44 |
| β-strand | 505-508 | 4 | 44 |
| α-helix | 509-511 | 3 | |
| α-helix | 512-517 | 6 | |
Chain H: 20 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 167-170 | 4 | |
| α-helix | 178-180 | 3 | |
| α-helix | 192-194 | 3 | |
| α-helix | 205-215 | 11 | |
| α-helix | 222-239 | 18 | |
| α-helix | 242-243 | 2 | |
| α-helix | 248-266 | 19 | |
| α-helix | 271-285 | 15 | |
| α-helix | 293-308 | 16 | |
| α-helix | 309-313 | 5 | |
| α-helix | 315-323 | 9 | |
| β-strand | 333-335 | 3 | 21 |
| α-helix | 340-350 | 11 | |
| β-strand | 358-362 | 5 | 21 |
| α-helix | 370-377 | 8 | |
| β-strand | 383-387 | 5 | 21 |
| α-helix | 388-390 | 3 | |
| α-helix | 391-394 | 4 | |
| β-strand | 400-402 | 3 | 21 |
| β-strand | 407-408 | 2 | 46 |
| β-strand | 414-417 | 4 | 46 |
| α-helix | 421-429 | 9 | |
| α-helix | 433-434 | 2 | |
| β-strand | 435-437 | 3 | 47 |
| α-helix | 440-442 | 3 | |
| β-strand | 489-492 | 4 | 46 |
| β-strand | 499-502 | 4 | 47 |
| β-strand | 505-508 | 4 | 47 |
| α-helix | 509-511 | 3 | |
| α-helix | 512-517 | 6 | |
6 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Translation initiation factor eIF-2B subunit alpha | A, B | protein | 305 | Homo sapiens | Q14232 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit beta | C, D | protein | 351 | Homo sapiens | P49770 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit gamma | E, F | protein | 452 | Homo sapiens | Q9NR50 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit delta | G, H | protein | 523 | Homo sapiens | Q9UI10 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit epsilon | I, J | protein | 721 | Homo sapiens | Q13144 |
| Eukaryotic translation initiation factor 2 subunit 1 | K, L | protein | 315 | Homo sapiens | P05198 |
| Eukaryotic translation initiation factor 2 subunit 2 | M | protein | 333 | Homo sapiens | P20042 |
| Eukaryotic translation initiation factor 2 subunit 3 | P | protein | 472 | Homo sapiens | P41091 |
Sequence of entity 1 (A, B), FASTA
>7D43_1 Translation initiation factor eIF-2B subunit alpha (chains A, B)
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVD
SSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIK
DGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLD
AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL
IKLYL
Sequence of entity 2 (C, D), FASTA
>7D43_2 Translation initiation factor eIF-2B subunit beta (chains C, D)
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL
Sequence of entity 3 (E, F), FASTA
>7D43_3 Translation initiation factor eIF-2B subunit gamma (chains E, F)
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQ
KALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDL
FRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEEL
VIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC
YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP
ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
Sequence of entity 4 (G, H), FASTA
>7D43_4 Translation initiation factor eIF-2B subunit delta (chains G, H)
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
Sequence of entity 5 (I, J), FASTA
>7D43_5 Translation initiation factor eIF-2B subunit epsilon (chains I, J)
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPIS
KDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVV
RIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSV
MTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARV
SNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENV
LLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDS
RGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVV
LEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALG
ISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D
Sequence of entity 6 (K, L), FASTA
>7D43_6 Eukaryotic translation initiation factor 2 subunit 1 (chains K, L)
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
Sequence of entity 7 (M), FASTA
>7D43_7 Eukaryotic translation initiation factor 2 subunit 2 (chains M)
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEED
TRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIM
LGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELL
NRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFL
LAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFL
QCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN
Sequence of entity 8 (P), FASTA
>7D43_8 Eukaryotic translation initiation factor 2 subunit 3 (chains P)
MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGT
KGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGI
VSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Primary citation
ISRIB Blunts the Integrated Stress Response by Allosterically Antagonising the Inhibitory Effect of Phosphorylated eIF2 on eIF2B. Zyryanova, A.F., Kashiwagi, K., Rato, C. et al. Mol Cell (2021) 81:88. DOI 10.1016/j.molcel.2020.10.031 · PubMed
Other PDB entries of the same protein (UniProt Q14232 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9Y4B 2.1 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 9ZUZ 2.25 Å, Translation Initiation Factor eIF-2B complex with the Isohexide Diamine GSK735
- 7VLK 2.27 Å, eIF2B-SFSV NSs C2-imposed
- 9Y3U 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 9Y4W 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 7F64 2.42 Å, eIF2B-SFSV NSs
- 9Y3T 2.5 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 7RLO 2.6 Å, Structure of the human eukaryotic translation initiation factor 2B (eIF2B) in complex…
- 3ECS 2.65 Å, Crystal structure of human eIF2B alpha
- 7KMA 2.7 Å, Crystal structure of eif2Balpha with a ligand.
- 9HVE 2.7 Å, Native human eIF2-eIF2B complex
- 7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2
Browse structure collections
About this viewer
MolViewer shows 7D43 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.