7D43: EIF2B-eIF2(aP), aPg complex

eIF2B-eIF2(aP), aPg complex. Determined by electron microscopy at 4.3 Å resolution. Released 9 Dec 2020.

Method: Electron microscopy
Resolution: 4.3 Å
Organism: Homo sapiens
Chains: 14
Atoms: 31,009
Mol. weight: 684.52 kDa
Released: 9 Dec 2020

Explore 7D43 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7D43 contains 170 α-helices and 231 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	4-16	13
α-helix	22-35	14
α-helix	46-56	11
α-helix	63-76	14
α-helix	88-115	28
α-helix	116-118	3
β-strand	125-126	2	1
α-helix	133-143	11
β-strand	150-153	4	1
α-helix	160-169	10
β-strand	175-178	4	1
α-helix	180-183	4
α-helix	185-188	4
β-strand	193-196	4	1
β-strand	200-201	2	2
β-strand	206-209	4	2
α-helix	212-219	8
β-strand	226-229	4	1
α-helix	232-234	3
β-strand	235-236	2	2
α-helix	248-251	4
β-strand	273-276	4	2
β-strand	283	1	1
β-strand	286	1	3
β-strand	289	1	3
α-helix	294-304	11

Chain B: 13 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	3-15	13
α-helix	22-35	14
α-helix	46-59	14
α-helix	63-74	12
α-helix	88-115	28
β-strand	124-126	3	4
α-helix	132-143	12
β-strand	149-152	4	4
α-helix	161-168	8
α-helix	169-171	3
β-strand	175-177	3	4
α-helix	180-182	3
α-helix	183-186	4
β-strand	193	1	5
β-strand	196	1	6
β-strand	200	1	7
β-strand	206	1	7
β-strand	207-209	3	8
α-helix	212-221	10
β-strand	226	1	5
β-strand	227	1	9
β-strand	229	1	6
α-helix	232-234	3
β-strand	235	1	7
β-strand	273-275	3	8
β-strand	283	1	9
β-strand	286	1	10
β-strand	289	1	10
α-helix	294-304	11

Chain C: 16 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	9-24	16
α-helix	31-47	17
α-helix	54-71	18
α-helix	77-95	19
α-helix	129-158	30
β-strand	164-167	4	11
α-helix	172-181	10
β-strand	188-191	4	11
α-helix	202-209	8
β-strand	214-216	3	11
α-helix	219-221	3
α-helix	222-225	4
α-helix	226-228	3
β-strand	232-234	3	12
β-strand	239	1	13
β-strand	246-248	3	14
α-helix	252-261	10
β-strand	265-267	3	12
α-helix	271-273	3
β-strand	274	1	13
β-strand	288	1	15
α-helix	302-304	3
β-strand	306-308	3	16
β-strand	311	1	15
β-strand	313-315	3	14
α-helix	318-320	3
β-strand	323	1	12
α-helix	335-342	8
α-helix	346-348	3

Chain D: 18 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	9-23	15
α-helix	31-48	18
α-helix	54-71	18
α-helix	76-97	22
α-helix	128-145	18
α-helix	147-154	8
α-helix	155-157	3
β-strand	164-166	3	17
α-helix	172-181	10
β-strand	188-193	6	17
α-helix	194	1
α-helix	200-210	11
β-strand	214-218	5	17
α-helix	219-221	3
α-helix	222-225	4
α-helix	226-228	3
β-strand	231-232	2	17
β-strand	233-234	2	18
β-strand	238-239	2	19
β-strand	245-248	4	19
α-helix	251-259	9
β-strand	266-267	2	18
β-strand	274	1	19
β-strand	288	1	20
α-helix	297-299	3
β-strand	306-307	2	21
β-strand	311	1	20
β-strand	313-315	3	19
α-helix	318-320	3
α-helix	333-342	10
α-helix	347-349	3

Chain E: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	22
α-helix	37-44	8
β-strand	52-54	3	22
α-helix	63-67	5
β-strand	76-78	3	22
α-helix	86-93	8
β-strand	103	1	23
β-strand	108	1	24
α-helix	115-121	7
β-strand	129-133	5	25
β-strand	158-161	4	26
β-strand	167-169	3	26
α-helix	173-175	3
β-strand	182	1	27
α-helix	184-187	4
β-strand	193-196	4	26
β-strand	200	1	25
β-strand	205	1	23
α-helix	209-216	8
α-helix	224-228	5
α-helix	229-235	7
β-strand	264-268	5	25
β-strand	273	1	24
α-helix	282-291	10
β-strand	364	1	28
β-strand	379-381	3	28
β-strand	392	1	29
β-strand	396-398	3	28
β-strand	409	1	29
β-strand	413-414	2	30
β-strand	430-431	2	30

Chain F: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	31
α-helix	38-45	8
β-strand	52-54	3	31
α-helix	65-68	4
β-strand	76-78	3	31
α-helix	86-93	8
α-helix	94-96	3
β-strand	102	1	32
β-strand	108-109	2	33
α-helix	115-123	9
β-strand	132-133	2	34
β-strand	158-161	4	35
β-strand	169-170	2	35
α-helix	184-189	6
β-strand	192-196	5	35
β-strand	200-201	2	34
β-strand	206	1	32
α-helix	209-217	9
α-helix	224-228	5
α-helix	229-234	6
β-strand	267-268	2	34
β-strand	272-273	2	33
α-helix	281-291	11
β-strand	381	1	36
β-strand	391-392	2	37
β-strand	396-397	2	38
β-strand	398	1	36
β-strand	408-409	2	37
β-strand	413-414	2	38
β-strand	425	1	39
β-strand	426	1	37
β-strand	443	1	39

Chain G: 20 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	168-171	4
α-helix	178-181	4
β-strand	185	1	40
α-helix	192-194	3
α-helix	205-215	11
α-helix	222-239	18
α-helix	248-266	19
α-helix	268-270	3
α-helix	271-284	14
α-helix	293-308	16
α-helix	309-313	5
α-helix	315-324	10
β-strand	334-335	2	16
β-strand	336	1	41
α-helix	340-351	12
β-strand	359-362	4	16
α-helix	369-377	9
β-strand	383-387	5	16
α-helix	388-390	3
α-helix	391-394	4
β-strand	401	1	42
β-strand	403	1	41
β-strand	407	1	43
β-strand	414-417	4	43
α-helix	421-430	10
β-strand	434	1	42
β-strand	435-437	3	44
α-helix	440-442	3
β-strand	457	1	40
α-helix	460-463	4
β-strand	467	1	45
β-strand	470	1	45
β-strand	482-483	2	11
β-strand	487	1	40
β-strand	489-492	4	43
β-strand	499-502	4	44
β-strand	505-508	4	44
α-helix	509-511	3
α-helix	512-517	6

Chain H: 20 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	167-170	4
α-helix	178-180	3
α-helix	192-194	3
α-helix	205-215	11
α-helix	222-239	18
α-helix	242-243	2
α-helix	248-266	19
α-helix	271-285	15
α-helix	293-308	16
α-helix	309-313	5
α-helix	315-323	9
β-strand	333-335	3	21
α-helix	340-350	11
β-strand	358-362	5	21
α-helix	370-377	8
β-strand	383-387	5	21
α-helix	388-390	3
α-helix	391-394	4
β-strand	400-402	3	21
β-strand	407-408	2	46
β-strand	414-417	4	46
α-helix	421-429	9
α-helix	433-434	2
β-strand	435-437	3	47
α-helix	440-442	3
β-strand	489-492	4	46
β-strand	499-502	4	47
β-strand	505-508	4	47
α-helix	509-511	3
α-helix	512-517	6

6 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Translation initiation factor eIF-2B subunit alpha	A, B	protein	305	Homo sapiens	Q14232 (AlphaFold model)
Translation initiation factor eIF-2B subunit beta	C, D	protein	351	Homo sapiens	P49770 (AlphaFold model)
Translation initiation factor eIF-2B subunit gamma	E, F	protein	452	Homo sapiens	Q9NR50 (AlphaFold model)
Translation initiation factor eIF-2B subunit delta	G, H	protein	523	Homo sapiens	Q9UI10 (AlphaFold model)
Translation initiation factor eIF-2B subunit epsilon	I, J	protein	721	Homo sapiens	Q13144
Eukaryotic translation initiation factor 2 subunit 1	K, L	protein	315	Homo sapiens	P05198
Eukaryotic translation initiation factor 2 subunit 2	M	protein	333	Homo sapiens	P20042
Eukaryotic translation initiation factor 2 subunit 3	P	protein	472	Homo sapiens	P41091

Sequence of entity 1 (A, B), FASTA

>7D43_1 Translation initiation factor eIF-2B subunit alpha (chains A, B)
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVD
SSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIK
DGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLD
AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL
IKLYL

Sequence of entity 2 (C, D), FASTA

>7D43_2 Translation initiation factor eIF-2B subunit beta (chains C, D)
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL

Sequence of entity 3 (E, F), FASTA

>7D43_3 Translation initiation factor eIF-2B subunit gamma (chains E, F)
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQ
KALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDL
FRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEEL
VIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC
YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP
ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI

Sequence of entity 4 (G, H), FASTA

>7D43_4 Translation initiation factor eIF-2B subunit delta (chains G, H)
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ

Sequence of entity 5 (I, J), FASTA

>7D43_5 Translation initiation factor eIF-2B subunit epsilon (chains I, J)
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPIS
KDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVV
RIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSV
MTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARV
SNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENV
LLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDS
RGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVV
LEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALG
ISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D

Sequence of entity 6 (K, L), FASTA

>7D43_6 Eukaryotic translation initiation factor 2 subunit 1 (chains K, L)
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED

Sequence of entity 7 (M), FASTA

>7D43_7 Eukaryotic translation initiation factor 2 subunit 2 (chains M)
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEED
TRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIM
LGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELL
NRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFL
LAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFL
QCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN

Sequence of entity 8 (P), FASTA

>7D43_8 Eukaryotic translation initiation factor 2 subunit 3 (chains P)
MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGT
KGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGI
VSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD

Primary citation

ISRIB Blunts the Integrated Stress Response by Allosterically Antagonising the Inhibitory Effect of Phosphorylated eIF2 on eIF2B. Zyryanova, A.F., Kashiwagi, K., Rato, C. et al. Mol Cell (2021) 81:88. DOI 10.1016/j.molcel.2020.10.031 · PubMed

Other PDB entries of the same protein (UniProt Q14232 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y4B 2.1 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
9ZUZ 2.25 Å, Translation Initiation Factor eIF-2B complex with the Isohexide Diamine GSK735
7VLK 2.27 Å, eIF2B-SFSV NSs C2-imposed
9Y3U 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
9Y4W 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7F64 2.42 Å, eIF2B-SFSV NSs
9Y3T 2.5 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7RLO 2.6 Å, Structure of the human eukaryotic translation initiation factor 2B (eIF2B) in complex…
3ECS 2.65 Å, Crystal structure of human eIF2B alpha
7KMA 2.7 Å, Crystal structure of eif2Balpha with a ligand.
9HVE 2.7 Å, Native human eIF2-eIF2B complex
7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2

Browse structure collections

About this viewer

MolViewer shows 7D43 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.