Crystal Structure of zebrafish PHF14-PZP in complex with H3(1-25). Determined by X-ray diffraction at 2.11 Å resolution. Released 28 Jul 2021.
Explore 7D87 in 3D Show helices and sheets RCSB PDB PDBe
7D87 contains 11 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 302-304 | 3 | 1 |
| β-strand | 311-313 | 3 | 1 |
| α-helix | 314-317 | 4 | |
| α-helix | 322-325 | 4 | |
| α-helix | 327-330 | 4 | |
| β-strand | 335-336 | 2 | 2 |
| α-helix | 341-344 | 4 | |
| β-strand | 361-363 | 3 | 3 |
| β-strand | 364 | 1 | 4 |
| β-strand | 369-371 | 3 | 3 |
| α-helix | 372-377 | 6 | |
| β-strand | 382-383 | 2 | 4 |
| β-strand | 392-393 | 2 | 4 |
| α-helix | 396-400 | 5 | |
| α-helix | 413-415 | 3 | |
| β-strand | 421-423 | 3 | 5 |
| β-strand | 432-434 | 3 | 5 |
| α-helix | 435-440 | 6 | |
| β-strand | 444-446 | 3 | 6 |
| α-helix | 449-451 | 3 | |
| β-strand | 457-459 | 3 | 6 |
| α-helix | 467-484 | 18 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 2 |
| α-helix | 5-7 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PHD finger protein 14 | A | protein | 211 | Danio rerio | A0A286Y9D1 (AlphaFold model) |
| Gene for histone H3 (germline gene) | E | protein | 25 | Homo sapiens | V9H1G0 (AlphaFold model) |
>7D87_1 PHD finger protein 14 (chains A) SSSQRMEHILICCVCLGDNSEDADEIIQCDNCGVTVHEGCYGVDGESDSIMSSASENSTE PWFCDACKNGVSPSCELCPSQDGIFKETDAGRWVHVVCALYVPGVAFGDIDKLRPVTLTE MNYSKYGAKECSLCEDTRFARTGVCISCDAGMCRSFFHVTCAQREGLLSEAAAEEDIADP FFAYCKQHADRFDRKWKRKNYLALQSYCKVS
>7D87_2 Gene for histone H3 (germline gene) (chains E) ARTKQTARKSTGGKAPRKQLATKAA
Molecular basis for bipartite recognition of histone H3 by the PZP domain of PHF14. Zheng, S., Bi, Y., Chen, H. et al. Nucleic Acids Res (2021) 49:8961-8973. DOI 10.1093/nar/gkab670 · PubMed
Other PDB entries of the same protein (UniProt A0A286Y9D1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7D87 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.