CRTC1 pSer64 peptide in complex with 14-3-3 zeta. Determined by X-ray diffraction at 2.42 Å resolution. Released 24 Feb 2021.
Explore 7D8H in 3D Show helices and sheets RCSB PDB PDBe
7D8H contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-30 | 12 | |
| α-helix | 35-37 | 3 | |
| α-helix | 38-68 | 31 | |
| α-helix | 73-100 | 28 | |
| α-helix | 101-105 | 5 | |
| α-helix | 112-130 | 19 | |
| α-helix | 136-159 | 24 | |
| α-helix | 165-180 | 16 | |
| α-helix | 187-201 | 15 | |
| α-helix | 203-205 | 3 | |
| α-helix | 211-228 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 14-3-3 protein zeta/delta | A | protein | 265 | Homo sapiens | P63104 (AlphaFold model) |
| CRTC1 pSer64 peptide | B | protein | 11 | Homo sapiens | Q6UUV9 (AlphaFold model) |
>7D8H_1 14-3-3 protein zeta/delta (chains A) MGSSHHHHHHSSGLVPRGSHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEE RNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSL LEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEM QPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQL LRDNLTLWTSDTQGDEAEAGEGGEN
>7D8H_2 CRTC1 pSer64 peptide (chains B) QYYGGSLPNVN
Structural Insights into the Interaction Between CRTCs and 14-3-3. Chen, H., Zhang, H., Chen, P. et al. J Mol Biol (2021) 433:166874-166874. DOI 10.1016/j.jmb.2021.166874 · PubMed
Other PDB entries of the same protein (UniProt P63104 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7D8H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.