7DFP: Human dopamine D2 receptor

Human dopamine D2 receptor in complex with spiperone. Determined by X-ray diffraction at 3.1 Å resolution. Released 30 Dec 2020.

Method: X-ray diffraction
Resolution: 3.1 Å
Organisms: Homo sapiens, Escherichia coli, Mus musculus
Chains: 3
Atoms: 5,925
Mol. weight: 88.31 kDa
Ligands: SIP
Released: 30 Dec 2020

Explore 7DFP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DFP contains 33 α-helices and 43 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	36-61	26
α-helix	63-65	3
α-helix	68-82	15
α-helix	83-87	5
α-helix	88-97	10
α-helix	104-137	34
α-helix	149-169	21
α-helix	170-174	5
α-helix	187-193	7
α-helix	194-199	6
α-helix	200-214	15
α-helix	1004-1019	16
α-helix	1024-1037	14
α-helix	1067-1080	14
α-helix	1084-399	59
α-helix	405-429	25
α-helix	431-440	10

Chain B: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	44-49	6	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	85-90	6	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	3
α-helix	112-113	2
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	144-150	7	5
β-strand	153-155	3	5
β-strand	159-163	5	4
α-helix	164-167	4
β-strand	173-182	10	4
α-helix	183-186	4
β-strand	191-198	8	5
α-helix	204	1
β-strand	205-210	6	5
α-helix	211-213	3

Chain C: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
β-strand	10-12	3	2
β-strand	18-25	8	6
α-helix	33	1
β-strand	34-39	6	2
β-strand	45-51	7	2
β-strand	58-60	3	2
β-strand	65	1	6
β-strand	68-73	6	6
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-99	8	2
β-strand	107-110	4	2
β-strand	114-118	5	2
α-helix	121-123	3
β-strand	124	1	7
α-helix	125-126	2
β-strand	127-131	5	8
β-strand	142-152	11	8
β-strand	153	1	7
β-strand	158-161	4	9
α-helix	162-164	3
β-strand	166	1	9
β-strand	171-178	8	8
β-strand	181-191	11	8
α-helix	192-194	3
β-strand	201-206	6	9
β-strand	211-216	6	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
D(2) dopamine receptor,Soluble cytochrome b562	A	protein	360	Homo sapiens, Escherichia coli	P0ABE7 (AlphaFold model), P14416 (AlphaFold model)
FabL	B	protein	215	Mus musculus
FabH	C	protein	220	Mus musculus

Sequence of entity 1 (A), FASTA

>7DFP_1 D(2) dopamine receptor,Soluble cytochrome b562 (chains A)
MNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVY
LEVVGEWKFSRIHCDIFVTLDVMMCTAKIWNLCAISIDRYTAVAMPMLYNTRYSSKRRVT
VMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIY
IVLRRRRADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAGSGSGDILVGQID
DALKLANEGKVKEAQAAAEQLKTTINAYIQKYGSQQKEKKATQMLAIVLGVFIICWLPFF
ITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHCGENLYFQ

Sequence of entity 2 (B), FASTA

>7DFP_2 FabL (chains B)
DIVMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLLYYTSRLHSGVPS
RFSGSGSGTDYSLTISNLEPEDIATYYCQQYSKLPRTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECN

Sequence of entity 3 (C), FASTA

>7DFP_3 FabH (chains C)
EVQLQQSGAELVKPGASVKISCKASGYSFTGYNMNWVKQSRGKSLEWIGYINPFYGTTNY
NQRFKGKATLTVDKSSSTAYIQLNSLTSEDSAVYYCARRYLTGTGAMDYWGQGTSVTVSS
AKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSG
LYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS

Ligands and cofactors

ID	Name	Formula	Copies
SIP	8-[4-(4-fluorophenyl)-4-oxidanylidene-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]dec…	C23 H26 F N3 O2	1

Primary citation

Structure of the dopamine D 2 receptor in complex with the antipsychotic drug spiperone. Im, D., Inoue, A., Fujiwara, T. et al. Nat Commun (2020) 11:6442-6442. DOI 10.1038/s41467-020-20221-0 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 7DFP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.