7E9C: 1:1 Orc1 BAH domain
Cryo-EM structure of the 1:1 Orc1 BAH domain in complex with nucleosome. Determined by electron microscopy at 3.5 Å resolution. Released 7 Sept 2022.
- Method
- Electron microscopy
- Resolution
- 3.5 Å
- Organisms
- Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Escherichia coli
- Chains
- 11
- Atoms
- 12,338
- Mol. weight
- 225.83 kDa
- Released
- 7 Sept 2022
Explore 7E9C in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7E9C contains 37 α-helices and 31 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 40-42 | 3 | |
| α-helix | 46-56 | 11 | |
| α-helix | 64-76 | 13 | |
| β-strand | 83-84 | 2 | 1 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 2 |
| α-helix | 121-129 | 9 | |
Chain B: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-28 | 4 | |
| α-helix | 31-41 | 11 | |
| β-strand | 45-46 | 2 | 2 |
| α-helix | 54-75 | 22 | |
| β-strand | 80-81 | 2 | 1 |
| α-helix | 84-92 | 9 | |
| β-strand | 97-98 | 2 | 3 |
Chain C: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 18-22 | 5 | |
| α-helix | 29-36 | 8 | |
| β-strand | 44 | 1 | 4 |
| α-helix | 47-72 | 26 | |
| α-helix | 81-90 | 10 | |
| α-helix | 92-97 | 6 | |
| β-strand | 101-102 | 2 | 5 |
Chain D: 4 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 41-51 | 11 | |
| α-helix | 59-86 | 28 | |
| β-strand | 92 | 1 | 4 |
| α-helix | 94-104 | 11 | |
| α-helix | 108-125 | 18 | |
Chain E: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 47-54 | 8 | |
| α-helix | 64-76 | 13 | |
| β-strand | 83-84 | 2 | 6 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 7 |
| α-helix | 121-131 | 11 | |
Chain F: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-28 | 3 | |
| α-helix | 31-41 | 11 | |
| β-strand | 45-46 | 2 | 7 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 6 |
| α-helix | 83-92 | 10 | |
| β-strand | 96-97 | 2 | 5 |
Chain G: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 18-21 | 4 | |
| α-helix | 28-37 | 10 | |
| β-strand | 43-44 | 2 | 8 |
| α-helix | 47-73 | 27 | |
| α-helix | 81-90 | 10 | |
| α-helix | 94-97 | 4 | |
| β-strand | 102-103 | 2 | 3 |
Chain H: 4 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 41-51 | 11 | |
| α-helix | 59-86 | 28 | |
| β-strand | 91-92 | 2 | 8 |
| α-helix | 94-104 | 11 | |
| α-helix | 108-124 | 17 | |
1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Histone H3 | A, E | protein | 134 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P61830 (AlphaFold model) |
| Histone H4 | B, F | protein | 103 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P02309 (AlphaFold model) |
| Histone H2A.2 | C, G | protein | 132 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P04912 (AlphaFold model) |
| Histone H2B.2 | D, H | protein | 131 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P02294 (AlphaFold model) |
| DNA (147-mer) | I | DNA | 147 | Escherichia coli | |
| DNA (147-mer) | J | DNA | 147 | Escherichia coli | |
| Origin recognition complex subunit 1 | K | protein | 218 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P54784 |
Sequence of entity 1 (A, E), FASTA
>7E9C_1 Histone H3 (chains A, E)
MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTI
QKKDIKLARRLRGE
Sequence of entity 2 (B, F), FASTA
>7E9C_2 Histone H4 (chains B, F)
MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLK
SFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
Sequence of entity 3 (C, G), FASTA
>7E9C_3 Histone H2A.2 (chains C, G)
MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYL
AAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPK
KSAKTAKASQEL
Sequence of entity 4 (D, H), FASTA
>7E9C_4 Histone H2B.2 (chains D, H)
MSSAAEKKPASKAPAEKKPAAKKTSTSVDGKKRSKVRKETYSSYIYKVLKQTHPDTGISQ
KSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSSTQA
Sequence of entity 5 (I), FASTA
>7E9C_5 DNA (147-mer) (chains I)
CTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAA
ACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCA
GGCACGTGTCAGATATATACATCCTGT
Sequence of entity 6 (J), FASTA
>7E9C_6 DNA (147-mer) (chains J)
ACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAA
AACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTG
AGCGGCCTCGGCACCGGGATTCTCCAG
Sequence of entity 7 (K), FASTA
>7E9C_7 Origin recognition complex subunit 1 (chains K)
AKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKLGRGDSVVMHNE
AAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNK
LFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTG
EKFVDINIEDVKAYIKKVEPREAQEYLKDLTLPSKKKE
Primary citation
Nucleosome binding relinquishes the association of the BAH domain of Orc1 with Sir1. Jiang, H., Yu, C., Liu, C.P. et al. To be published.
Other PDB entries of the same protein (UniProt P61830 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6KMJ 1.4 Å, Crystal structure of Sth1 bromodomain in complex with H3K14Ac
- 7F3S 1.4 Å, Crystal structure of Sth1 Bromodomain in complex with H3K14bz peptide
- 3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
- 8I3F 1.62 Å, Crystal structure of Rco1-Eaf3 with peptide of histone H3 N-terminal
- 2H2G 1.63 Å, The Structural Basis of Sirtuin substrate affinity
- 7F4E 1.78 Å, Crystal structure of Hst2 in complex with H3K9bz peptide
- 5D7E 1.9 Å, Crystal structure of Taf14 YEATS domain in complex with H3K9ac
- 7F4A 2.0 Å, Crystal structure of Taf14 YEATS domain in complex with H3K9bz peptide
- 1M1D 2.2 Å, Tetrahymena GCN5 with bound bisubstrate analog inhibitor
- 1QSN 2.2 Å, Crystal structure of tetrahymena GCN5 with bound coenzyme a and histone H3 peptide
- 2IDC 2.2 Å, Structure of the Histone H3-Asf1 Chaperone Interaction
- 5IOK 2.22 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9cr
Browse structure collections
About this viewer
MolViewer shows 7E9C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.