7F4A: Taf14 YEATS domain

Crystal structure of Taf14 YEATS domain in complex with H3K9bz peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 16 Mar 2022.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 2
Atoms: 1,267
Mol. weight: 16.67 kDa
Released: 16 Mar 2022

Explore 7F4A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7F4A contains 4 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-17	14	1
α-helix	22-23	2
β-strand	24	1	2
β-strand	27	1	2
α-helix	28-29	2
β-strand	30-39	10	1
β-strand	45-46	2	1
β-strand	51-57	7	3
β-strand	66-69	4	3
β-strand	76-80	5	1
β-strand	83	1	4
β-strand	84-92	9	3
α-helix	93-95	3
β-strand	97-105	9	3
β-strand	111-121	11	1
α-helix	125-131	7

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	8	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 14	A	protein	136	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P35189 (AlphaFold model)
Histone H3	B	protein	10	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P61830 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7F4A_1 Transcription initiation factor TFIID subunit 14 (chains A)
VATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPT
FANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIP
LNKPLLTEELAKSGST

Sequence of entity 2 (B), FASTA

>7F4A_2 Histone H3 (chains B)
XQTARKSTGG

Primary citation

Global profiling of regulatory elements in the histone benzoylation pathway. Wang, D., Yan, F., Wu, P. et al. Nat Commun (2022) 13:1369-1369. DOI 10.1038/s41467-022-29057-2 · PubMed

Other PDB entries of the same protein (UniProt P35189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UHE 1.66 Å, Taf14 ET domain in complex with C-terminal tail of Taf2
3QRL 1.7 Å, Crystal Structure of the Taf14 YEATS domain
6MIQ 1.75 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9bu
6MIO 1.85 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9pr
5D7E 1.9 Å, Crystal structure of Taf14 YEATS domain in complex with H3K9ac
6MIN 1.9 Å, Crystal structure of Taf14 YEATS domain G82A mutant in complex with histone H3K9cr
8U77 1.93 Å, Crystal structure of Taf14 in complex with Yng1
6MIP 2.0 Å, Crystal structure of Taf14 YEATS domain G82A mutant
5IOK 2.22 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9cr
9VKW 3.13 Å, Cryo-EM structure of the NuA3 complex bound to Ace-coenzyme A
9UUS 3.2 Å, The NuA3 histone acetyltransferase complex bound to acetyl-CoA and H3 tail
9UUO 3.68 Å, The NuA3 histone acetyltransferase complex

Browse structure collections

About this viewer

MolViewer shows 7F4A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.