7EA7: NAP1 LIR

crystal structure of NAP1 LIR in complex with GABARAP. Determined by X-ray diffraction at 2.69 Å resolution. Released 22 Dec 2021.

Method: X-ray diffraction
Resolution: 2.69 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,999
Mol. weight: 29.21 kDa
Released: 22 Dec 2021

Explore 7EA7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EA7 contains 10 α-helices and 17 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	42-44	3
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-68	12
β-strand	77-79	3	1
β-strand	80	1	3
β-strand	83	1	3
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Chain B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	11-23	13
β-strand	28-35	8	4
α-helix	42-44	3
β-strand	48-52	5	4
β-strand	56	1	5
α-helix	57-68	12
β-strand	77-79	3	4
β-strand	80	1	6
β-strand	83	1	6
β-strand	90	1	5
α-helix	91-98	8
β-strand	105-110	6	4

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	10-11	2	4
α-helix	12-13	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor-associated protein	A, B	protein	117	Homo sapiens	O95166 (AlphaFold model)
NAP1_LIR motif	C	protein	11	Homo sapiens	Q9H6S1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7EA7_1 Gamma-aminobutyric acid receptor-associated protein (chains A, B)
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Sequence of entity 2 (C), FASTA

>7EA7_2 NAP1_LIR motif (chains C)
EDDICILNHEK

Primary citation

Structural and biochemical advances on the recruitment of the autophagy-initiating ULK and TBK1 complexes by autophagy receptor NDP52. Fu, T., Zhang, M., Zhou, Z. et al. Sci Adv (2021) 7. DOI 10.1126/sciadv.abi6582 · PubMed

Other PDB entries of the same protein (UniProt O95166 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HYO 1.07 Å, Structure of ULK1 LIR motif bound to GABARAP
6YOP 1.1 Å, Structure of SAMM50 LIR bound to GABARAP
7ZKR 1.1 Å, Human GABARAP in complex with stapled peptide Pen3-ortho
6HYN 1.14 Å, Structure of ATG13 LIR motif bound to GABARAP
7AA8 1.25 Å, Structure of SCOC LIR bound to GABARAP
6HOG 1.26 Å, Structure of VPS34 LIR motif bound to GABARAP
8T2M 1.27 Å, Crystal structure of GABARAP in complex with the LIR of NSs4
3D32 1.3 Å, Complex of GABA(A) receptor-associated protein (GABARAP) with a synthetic peptide
6HB9 1.3 Å, Crystal structure of the GABARAP in complex with the UBA5 LIR motif
7BRQ 1.4 Å, Crystal structure of human FAM134B LIR fused to human GABARAP
9I9X 1.42 Å, Human GABARAP in complex with artificial peptide IM-2
9HGD 1.5 Å, Crystal structure of human GABARAP in complex with cyclic peptide GAB_D23

Browse structure collections

About this viewer

MolViewer shows 7EA7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.