7EAL: A20-Binding Inhibitor of NF-kB 1
The structure of the A20-Binding Inhibitor of NF-kB 1 in complex with di-ubiquitin. Determined by X-ray diffraction at 2.5 Å resolution. Released 21 Jul 2021.
- Method
- X-ray diffraction
- Resolution
- 2.5 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 4,579
- Mol. weight
- 85.29 kDa
- Released
- 21 Jul 2021
Explore 7EAL in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7EAL contains 20 α-helices and 28 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-7 | 6 | 1 |
| β-strand | 12-16 | 5 | 1 |
| β-strand | 22 | 1 | 2 |
| α-helix | 23-34 | 12 | |
| α-helix | 38-40 | 3 | |
| β-strand | 41-45 | 5 | 1 |
| β-strand | 48-49 | 2 | 1 |
| α-helix | 50-51 | 2 | |
| β-strand | 55 | 1 | 2 |
| α-helix | 57-59 | 3 | |
| β-strand | 66-71 | 6 | 1 |
| β-strand | 102-106 | 5 | 3 |
| β-strand | 112-116 | 5 | 3 |
| β-strand | 122 | 1 | 4 |
| α-helix | 123-134 | 12 | |
| α-helix | 138-140 | 3 | |
| β-strand | 141-145 | 5 | 3 |
| β-strand | 148-149 | 2 | 3 |
| α-helix | 150-151 | 2 | |
| β-strand | 155 | 1 | 4 |
| β-strand | 166-171 | 6 | 3 |
Chain B: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 455-510 | 56 | |
Chain C: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 455-509 | 55 | |
Chain D: 9 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-7 | 6 | 5 |
| β-strand | 12-16 | 5 | 5 |
| β-strand | 22 | 1 | 6 |
| α-helix | 23-34 | 12 | |
| α-helix | 38-40 | 3 | |
| β-strand | 41-45 | 5 | 5 |
| β-strand | 48-49 | 2 | 5 |
| α-helix | 50-51 | 2 | |
| β-strand | 55 | 1 | 6 |
| α-helix | 57-59 | 3 | |
| β-strand | 66-71 | 6 | 5 |
| β-strand | 101-107 | 7 | 7 |
| β-strand | 112-117 | 6 | 7 |
| β-strand | 122 | 1 | 8 |
| α-helix | 123-134 | 12 | |
| α-helix | 138-140 | 3 | |
| β-strand | 141-145 | 5 | 7 |
| β-strand | 148-149 | 2 | 7 |
| α-helix | 150-151 | 2 | |
| β-strand | 155 | 1 | 8 |
| α-helix | 157-159 | 3 | |
| α-helix | 161-162 | 2 | |
| β-strand | 166-171 | 6 | 7 |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 452-512 | 61 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 448-510 | 63 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| ubiquitin | A, D | protein | 152 | Homo sapiens | P0CG48 (AlphaFold model) |
| TNFAIP3-interacting protein 1 | B, C, E, F | protein | 109 | Homo sapiens | Q15025 (AlphaFold model) |
Sequence of entity 1 (A, D), FASTA
>7EAL_1 ubiquitin (chains A, D)
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
Sequence of entity 2 (B, C, E, F), FASTA
>7EAL_2 TNFAIP3-interacting protein 1 (chains B, C, E, F)
LTRQREYQEKEIQRLNKALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQ
QVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQAQVTLSNTQLKAFKD
Primary citation
Structural and Biochemical Basis for Higher-Order Assembly between A20-Binding Inhibitor of NF-kappa B 1 (ABIN1) and M1-Linked Ubiquitins. Hong, J.Y., Lin, S.C., Kuo, B.J. et al. J Mol Biol (2021) 433:167116-167116. DOI 10.1016/j.jmb.2021.167116 · PubMed
Other PDB entries of the same protein (UniProt P0CG48 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6Q00 0.85 Å, TDP2 UBA Domain Bound to Ubiquitin at 0.85 Angstroms Resolution, Crystal Form 1
- 1OGW 1.32 Å, Synthetic Ubiquitin with fluoro-Leu at 50 and 67
- 5NL4 1.32 Å, Crystal structure of Zn1.3-E16V human ubiquitin (hUb) mutant adduct, from a solution 35…
- 2GBJ 1.35 Å, Crystal Structure of the 9-10 8 Glycine Insertion Mutant of Ubiquitin.
- 4HK2 1.4 Å, U7Ub25.2540
- 9FJ3 1.4 Å, Structure of ubiquitin bound of coiled-coil UIM form 2
- 1XD3 1.45 Å, Crystal structure of UCHL3-UbVME complex
- 4IUM 1.45 Å, Equine arteritis virus papain-like protease 2 (PLP2) covalently bound to ubiquitin
- 7UV5 1.45 Å, The crystal structure of Papain-Like Protease of SARS CoV-2, C111S/D286N mutant, in…
- 5NLF 1.5 Å, Crystal structure of Zn2.7-E16V human ubiquitin (hUb) mutant adduct, from a solution 100…
- 9F6G 1.5 Å, Human USP30 chimera bound to Ubiquitin-PA
- 9OVX 1.5 Å, Crystal structure of ubiquitin K27M mutant
Browse structure collections
About this viewer
MolViewer shows 7EAL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.