7EAO: A20-binding inhibitor of NF-kB 1

The structure of the A20-binding inhibitor of NF-kB 1 in complex with tri-ubiquitin. Determined by X-ray diffraction at 2.9 Å resolution. Released 21 Jul 2021.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,844
Mol. weight: 48.49 kDa
Released: 21 Jul 2021

Explore 7EAO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EAO contains 10 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	12-16	5	1
β-strand	22	1	2
α-helix	23-32	10
α-helix	38-40	3
β-strand	41-45	5	1
β-strand	48-49	2	1
α-helix	50-51	2
β-strand	55	1	2
α-helix	56-59	4
β-strand	66-71	6	1
β-strand	102-106	5	3
β-strand	112-116	5	3
β-strand	122	1	4
α-helix	123-134	12
α-helix	138-140	3
β-strand	141-145	5	3
β-strand	148-149	2	3
β-strand	155	1	4
β-strand	166-171	6	3
β-strand	202-206	5	5
β-strand	212-216	5	5
β-strand	222	1	6
α-helix	223-234	12
α-helix	238-240	3
β-strand	241-245	5	5
β-strand	248-249	2	5
β-strand	255	1	6
β-strand	266-271	6	5

Chains B and C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	453-511	59

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polyubiquitin-C	A	protein	228	Homo sapiens	P0CG48 (AlphaFold model)
TNFAIP3-interacting protein 1	B, C	protein	99	Homo sapiens	Q15025 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7EAO_1 Polyubiquitin-C (chains A)
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG

Sequence of entity 2 (B, C), FASTA

>7EAO_2 TNFAIP3-interacting protein 1 (chains B, C)
EIQRLNKALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIFEEDFQ
RERSDRERMNEEKEELKKQVEKLQAQVTLSNTQLKAFKD

Primary citation

Structural and Biochemical Basis for Higher-Order Assembly between A20-Binding Inhibitor of NF-kappa B 1 (ABIN1) and M1-Linked Ubiquitins. Hong, J.Y., Lin, S.C., Kuo, B.J. et al. J Mol Biol (2021) 433:167116-167116. DOI 10.1016/j.jmb.2021.167116 · PubMed

Other PDB entries of the same protein (UniProt P0CG48 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Q00 0.85 Å, TDP2 UBA Domain Bound to Ubiquitin at 0.85 Angstroms Resolution, Crystal Form 1
1OGW 1.32 Å, Synthetic Ubiquitin with fluoro-Leu at 50 and 67
5NL4 1.32 Å, Crystal structure of Zn1.3-E16V human ubiquitin (hUb) mutant adduct, from a solution 35…
2GBJ 1.35 Å, Crystal Structure of the 9-10 8 Glycine Insertion Mutant of Ubiquitin.
4HK2 1.4 Å, U7Ub25.2540
9FJ3 1.4 Å, Structure of ubiquitin bound of coiled-coil UIM form 2
1XD3 1.45 Å, Crystal structure of UCHL3-UbVME complex
4IUM 1.45 Å, Equine arteritis virus papain-like protease 2 (PLP2) covalently bound to ubiquitin
7UV5 1.45 Å, The crystal structure of Papain-Like Protease of SARS CoV-2, C111S/D286N mutant, in…
5NLF 1.5 Å, Crystal structure of Zn2.7-E16V human ubiquitin (hUb) mutant adduct, from a solution 100…
9F6G 1.5 Å, Human USP30 chimera bound to Ubiquitin-PA
9OVX 1.5 Å, Crystal structure of ubiquitin K27M mutant

Browse structure collections

About this viewer

MolViewer shows 7EAO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.