7ENI: Cas and anti-cas protein complex

Crystal structure of cas and anti-cas protein complex. Determined by X-ray diffraction at 2.63 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 2.63 Å
Organisms: Staphylococcus aureus, Staphylococcus schleiferi
Chains: 3
Atoms: 11,460
Mol. weight: 163.72 kDa
Ligands: PO4
Released: 20 Apr 2022

Explore 7ENI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ENI contains 66 α-helices and 51 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 60 helices, 45 β-strands

Element	Residues	Length	Sheet
β-strand	5-11	7	1
β-strand	15-22	8	1
β-strand	28-35	8	1
α-helix	37-39	3
α-helix	41-73	33
α-helix	88-94	7
α-helix	102-114	13
β-strand	118	1	2
α-helix	121-123	3
α-helix	134-144	11
α-helix	150-161	12
α-helix	167-169	3
β-strand	172	1	2
α-helix	173-187	15
α-helix	195-206	12
α-helix	226-234	9
β-strand	236	1	3
β-strand	244	1	3
β-strand	245-247	3	4
α-helix	251-263	13
β-strand	266-267	2	5
α-helix	277-283	7
α-helix	284-288	5
α-helix	296-302	7
α-helix	307-309	3
β-strand	310-311	2	5
β-strand	314-315	2	6
β-strand	321-322	2	6
α-helix	327-333	7
α-helix	339-342	4
α-helix	345-357	13
α-helix	361-370	10
α-helix	377-383	7
β-strand	392-396	5	4
α-helix	397-409	13
α-helix	414-421	8
α-helix	423-425	3
α-helix	430-432	3
α-helix	440-443	4
α-helix	448-468	21
β-strand	473-478	6	1
α-helix	484-512	29
α-helix	515-519	5
α-helix	521-529	9
β-strand	533	1	7
β-strand	540	1	7
α-helix	543-548	6
α-helix	550-552	3
β-strand	553-557	5	8
α-helix	561-564	4
α-helix	569-571	3
β-strand	572-576	5	8
α-helix	577-583	7
α-helix	588-592	5
α-helix	601-613	13
α-helix	620-626	7
α-helix	635-645	11
β-strand	647	1	9
α-helix	651-666	16
β-strand	672-675	4	1
β-strand	676	1	9
α-helix	678-687	10
α-helix	699-717	19
α-helix	719-721	3
α-helix	722-728	7
α-helix	747-754	8
α-helix	760-764	5
β-strand	770-773	4	1
α-helix	774-775	2
β-strand	776	1	10
β-strand	789-790	2	11
β-strand	791-793	3	12
β-strand	799-805	7	12
α-helix	815-822	8
α-helix	824-826	3
β-strand	827	1	12
α-helix	828-832	5
α-helix	834-846	13
α-helix	853-861	9
β-strand	866	1	13
α-helix	867-868	2
α-helix	874-875	2
β-strand	876	1	13
α-helix	877	1
β-strand	880-886	7	12
β-strand	890-892	3	11
α-helix	894-896	3
β-strand	904-907	4	11
β-strand	911-919	9	14
β-strand	922-929	8	14
α-helix	930-932	3
β-strand	933-936	4	15
β-strand	939-942	4	15
α-helix	944-953	10
α-helix	960	1
β-strand	961-966	6	14
β-strand	968	1	10
β-strand	971-974	4	16
β-strand	977-986	10	16
β-strand	991-995	5	16
α-helix	1001-1007	7
β-strand	1016-1019	4	16
β-strand	1027-1032	6	16
β-strand	1038-1040	3	16
β-strand	1050-1051	2	15

Chain C: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	65	1	17
α-helix	72	1
β-strand	73-87	15	17
β-strand	92-104	13	17
β-strand	110-123	14	17
α-helix	127-128	2
α-helix	133-145	13
β-strand	150-156	7	17
α-helix	159-164	6
α-helix	165-169	5
β-strand	173	1	17
α-helix	176-183	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CRISPR-associated endonuclease Cas9	A	protein	1054	Staphylococcus aureus	J7RUA5 (AlphaFold model)
sgRNA (74-MER)	B	RNA	74	Staphylococcus aureus
AcrIIA13 protein	C	protein	128	Staphylococcus schleiferi	A0A915Q9D6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7ENI_1 CRISPR-associated endonuclease Cas9 (chains A)
SMKRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRR
RRHRIQRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVH
NVNEVEEDTGNELSTKEQISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKE
AKQLLKVQKAYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLMGHCTY
FPEELRSVKYAYNADLYNALNDLNNLVITRDENEKLEYYEKFQIIENVFKQKKKPTLKQI
AKEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKDITARKEIIENAELLDQIAKILTIYQ
SSEDIQEELTNLNSELTQEEIEQISNLKGYTGTHNLSLKAINLILDELWHTNDNQIAIFN
RLKLVPKKVDLSQQKEIPTTLVDDFILSPVVKRSFIQSIKVINAIIKKYGLPNDIIIELA
REKNSKDAQKMINEMQKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKCLYSLE
AIPLEDLLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEENSKKGNRTPFQYLSSSDSKI
SYETFKKHILNLAKGKGRISKTKKEYLLEERDINRFSVQKDFINRNLVDTRYATRGLMNL
LRSYFRVNNLDVKVKSINGGFTSFLRRKWKFKKERNKGYKHHAEDALIIANADFIFKEWK
KLDKAKKVMENQMFEEKQAESMPEIETEQEYKEIFITPHQIKHIKDFKDYKYSHRVDKKP
NRELINDTLYSTRKDDKGNTLIVNNLNGLYDKDNDKLKKLINKSPEKLLMYHHDPQTYQK
LKLIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYGNKLNAHLDITDDYPN
SRNKVVKLSLKPYRFDVYLDNGVYKFVTVKNLDVIKKENYYEVNSKCYEEAKKLKKISNQ
AEFIASFYNNDLIKINGELYRVIGVNNDLLNRIEVNMIDITYREYLENMNDKRPPRIIKT
IASKTQSIKKYSTDILGNLYEVKSKKHPQIIKKG

Sequence of entity 2 (B), FASTA

>7ENI_2 sgRNA (74-MER) (chains B)
GGUCUGCUAUUUCUAUUUACGUUUUAGUACUCUGGAAACAGAAUCUACUAAAACAAGGCA
AAAUGCCGUGUUUC

Sequence of entity 3 (C), FASTA

>7ENI_3 AcrIIA13 protein (chains C)
MNKSIEIKDQNNIVLIDSLGQFFTDIENDNNGRYNIDYVLLNEVEHDNGNTYYEVGMYRT
EEVPFSDKVTQDNVELLEDKWLQIDQQGESYVESIFFENEEDAREYIKLVLKGHETFEET
AKAIGVIK

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	9

Primary citation

Crystal structure of cas and anti-cas protein complex. Wang, Y., Li, X. To be published.

Other PDB entries of the same protein (UniProt J7RUA5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ENH 2.1 Å, Crystal structure of cas and anti-cas protein complex
7EL1 2.22 Å, Structure of a protein from bacteria
5CZZ 2.6 Å, Crystal structure of Staphylococcus aureus Cas9 in complex with sgRNA and target DNA…
5AXW 2.7 Å, Crystal structure of Staphylococcus aureus Cas9 in complex with sgRNA and target DNA…
8ZD0 2.76 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in a translocation state
9MB7 2.88 Å, Cryo-EM structure of eSaCas9-NNG-guide RNA-mismatched target DNA complex
8ZCZ 2.9 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in an intermediate state
8YWH 2.97 Å, Cryo-EM structure of small and dead form SaCas9-RNA-DNA ternary complex (sdCas9)
9MB6 3.01 Å, Cryo-EM structure of wild-type SaCas9-guide RNA-mismatched target DNA complex
8ZDA 3.14 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in a catalytically active…
8ZCY 3.17 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in an interrogation state
8JFT 3.31 Å, Cryo-EM structure of SaCas9-AcrIIA15 CTD-sgRNA complex

Browse structure collections

About this viewer

MolViewer shows 7ENI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.