7ENR: Cas and anti-cas protein complex

Crystal structure of cas and anti-cas protein complex. Determined by X-ray diffraction at 4.21 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 4.21 Å
Organisms: Staphylococcus aureus, Staphylococcus simulans
Chains: 3
Atoms: 10,498
Mol. weight: 167.4 kDa
Released: 20 Apr 2022

Explore 7ENR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ENR contains 62 α-helices and 49 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 53 helices, 42 β-strands

Element	Residues	Length	Sheet
β-strand	5-11	7	1
β-strand	15-22	8	1
β-strand	28-35	8	1
α-helix	37-39	3
α-helix	41-73	33
α-helix	88-94	7
α-helix	102-114	13
β-strand	118	1	2
α-helix	134-143	10
α-helix	150-160	11
β-strand	172	1	2
α-helix	173-187	15
α-helix	195-205	11
α-helix	226-234	9
β-strand	236	1	3
β-strand	244	1	3
β-strand	245-247	3	4
α-helix	251-263	13
β-strand	266-267	2	5
α-helix	277-283	7
α-helix	284-288	5
α-helix	296-302	7
α-helix	307-309	3
β-strand	310-311	2	5
β-strand	315	1	6
β-strand	321	1	6
α-helix	327-333	7
α-helix	339-343	5
α-helix	345-357	13
α-helix	361-369	9
α-helix	378-384	7
β-strand	392-396	5	4
α-helix	397-409	13
α-helix	414-421	8
α-helix	423-425	3
α-helix	439-443	5
α-helix	448-468	21
β-strand	473-478	6	1
α-helix	484-512	29
α-helix	517-520	4
α-helix	521-529	9
β-strand	533	1	7
β-strand	540	1	7
α-helix	543-548	6
α-helix	550-552	3
β-strand	553-557	5	8
α-helix	569-571	3
β-strand	572-576	5	8
α-helix	577-583	7
α-helix	588-592	5
α-helix	601-612	12
α-helix	620-626	7
α-helix	635-645	11
α-helix	651-666	16
β-strand	672-675	4	1
α-helix	678-688	11
α-helix	699-714	16
α-helix	722-727	6
α-helix	731-733	3
α-helix	747-750	4
α-helix	751-755	5
α-helix	760-764	5
β-strand	770-772	3	1
β-strand	789	1	9
β-strand	790-793	4	10
β-strand	799-805	7	10
α-helix	815-822	8
α-helix	824-826	3
β-strand	827	1	10
α-helix	829-832	4
α-helix	834-846	13
α-helix	853-861	9
β-strand	866	1	11
β-strand	876	1	11
β-strand	880-883	4	10
β-strand	890-892	3	9
α-helix	894-896	3
β-strand	905-907	3	9
β-strand	911-919	9	12
β-strand	922-929	8	12
α-helix	930-932	3
β-strand	933-936	4	13
β-strand	939-942	4	13
α-helix	944-953	10
β-strand	961-966	6	12
β-strand	971-974	4	14
β-strand	977-979	3	14
β-strand	980-986	7	15
α-helix	987-989	3
β-strand	991-995	5	15
α-helix	1001-1007	7
β-strand	1016-1019	4	15
β-strand	1027-1032	6	14
β-strand	1038-1040	3	14
β-strand	1050-1051	2	13

Chain C: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	65-72	8	16
β-strand	76-84	9	16
β-strand	88-98	11	16
α-helix	99-103	5
α-helix	107-109	3
α-helix	116-118	3
β-strand	119-122	4	16
α-helix	123-124	2
β-strand	129	1	17
α-helix	134	1
β-strand	135	1	17
α-helix	136	1
β-strand	137-138	2	16
α-helix	139-141	3
α-helix	143-149	7
α-helix	151-156	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CRISPR-associated endonuclease Cas9	A	protein	1053	Staphylococcus aureus	J7RUA5 (AlphaFold model)
sgRNA (98-MER)	B	RNA	98	Staphylococcus aureus
AcrIIA14	C	protein	100	Staphylococcus simulans

Sequence of entity 1 (A), FASTA

>7ENR_1 CRISPR-associated endonuclease Cas9 (chains A)
MKRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRRR
RHRIQRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHN
VNEVEEDTGNELSTKEQISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEA
KQLLKVQKAYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLMGHCTYF
PEELRSVKYAYNADLYNALNDLNNLVITRDENEKLEYYEKFQIIENVFKQKKKPTLKQIA
KEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKDITARKEIIENAELLDQIAKILTIYQS
SEDIQEELTNLNSELTQEEIEQISNLKGYTGTHNLSLKAINLILDELWHTNDNQIAIFNR
LKLVPKKVDLSQQKEIPTTLVDDFILSPVVKRSFIQSIKVINAIIKKYGLPNDIIIELAR
EKNSKDAQKMINEMQKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKCLYSLEA
IPLEDLLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEENSKKGNRTPFQYLSSSDSKIS
YETFKKHILNLAKGKGRISKTKKEYLLEERDINRFSVQKDFINRNLVDTRYATRGLMNLL
RSYFRVNNLDVKVKSINGGFTSFLRRKWKFKKERNKGYKHHAEDALIIANADFIFKEWKK
LDKAKKVMENQMFEEKQAESMPEIETEQEYKEIFITPHQIKHIKDFKDYKYSHRVDKKPN
RELINDTLYSTRKDDKGNTLIVNNLNGLYDKDNDKLKKLINKSPEKLLMYHHDPQTYQKL
KLIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYGNKLNAHLDITDDYPNS
RNKVVKLSLKPYRFDVYLDNGVYKFVTVKNLDVIKKENYYEVNSKCYEEAKKLKKISNQA
EFIASFYNNDLIKINGELYRVIGVNNDLLNRIEVNMIDITYREYLENMNDKRPPRIIKTI
ASKTQSIKKYSTDILGNLYEVKSKKHPQIIKKG

Sequence of entity 2 (B), FASTA

>7ENR_2 sgRNA (98-MER) (chains B)
GGUCUGCUAUUUCUAUUUACGUUUUAGUACUCUGGAAACAGAAUCUACUAAAACAAGGCA
AAAUGCCGUGUUUAUCUCGUCAACUUGUUGGCGAGAUC

Sequence of entity 3 (C), FASTA

>7ENR_3 AcrIIA14 (chains C)
MKSVKYISNMSKQEKGYRVYVNVVNEDTDKGFLFPSVPKEVIENDKIDELFNFEHHKPYV
QKAKSRYDKNGIGYKIVQLDEGFQKFIELNKEKMKENLDY

Primary citation

Crystal structure of cas and anti-cas protein complex. Wang, Y., Li, X. To be published.

Other PDB entries of the same protein (UniProt J7RUA5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ENH 2.1 Å, Crystal structure of cas and anti-cas protein complex
7EL1 2.22 Å, Structure of a protein from bacteria
5CZZ 2.6 Å, Crystal structure of Staphylococcus aureus Cas9 in complex with sgRNA and target DNA…
7ENI 2.63 Å, Crystal structure of cas and anti-cas protein complex
5AXW 2.7 Å, Crystal structure of Staphylococcus aureus Cas9 in complex with sgRNA and target DNA…
8ZD0 2.76 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in a translocation state
9MB7 2.88 Å, Cryo-EM structure of eSaCas9-NNG-guide RNA-mismatched target DNA complex
8ZCZ 2.9 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in an intermediate state
8YWH 2.97 Å, Cryo-EM structure of small and dead form SaCas9-RNA-DNA ternary complex (sdCas9)
9MB6 3.01 Å, Cryo-EM structure of wild-type SaCas9-guide RNA-mismatched target DNA complex
8ZDA 3.14 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in a catalytically active…
8ZCY 3.17 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in an interrogation state

Browse structure collections

About this viewer

MolViewer shows 7ENR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.