7EPE: MGlu2

Crystal structure of mGlu2 bound to NAM563. Determined by X-ray diffraction at 2.5 Å resolution. Released 23 Jun 2021.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,955
Mol. weight: 49.37 kDa
Ligands: J9R, FMN
Released: 23 Jun 2021

Explore 7EPE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EPE contains 21 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	566-568	3
α-helix	569-591	23
α-helix	596-599	4
α-helix	603-624	22
α-helix	626-627	2
α-helix	629-660	32
β-strand	1002-1008	7	1
α-helix	1013-1027	15
β-strand	1031-1036	6	1
α-helix	1037-1039	3
β-strand	1051-1056	6	1
β-strand	1058-1059	2	2
β-strand	1065-1066	2	2
α-helix	1071-1075	5
α-helix	1077-1079	3
β-strand	1086-1093	8	1
α-helix	1102-1114	13
β-strand	1117-1118	2	1
β-strand	1123-1126	4	1
α-helix	1129-1132	4
α-helix	1133-1143	11
α-helix	1144-1146	3
α-helix	676-700	25
β-strand	705	1	3
β-strand	721	1	3
α-helix	725-727	3
α-helix	730-748	19
α-helix	754-783	30
α-helix	787-805	19
α-helix	806-810	5
α-helix	811-819	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Metabotropic glutamate receptor 2	A	protein	446	Homo sapiens	P00323 (AlphaFold model), Q14416 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7EPE_1 Metabotropic glutamate receptor 2 (chains A)
DYKDDDGAPLPQEYIRWGDAWAVGPVTIACLGALATLFVLGVFVRHNATPVVKASGRELC
YILLGGVFLCYCMTFIFIAKPSTAVCTLRRLGLGTAFSVCYSALLTKTYRIARIFGAKAL
IVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSI
ELQDDFIPLFDSLEETGAQGRKVACFGCGDSSWEYFCGAVDAIEEKLKNLGAEIVQDGLR
IDGDPRAARDDIVGWAHDVRGAIPRFISPASQVAICLALISGQLLIVVAWLVVEAPGTGK
ETAPERREVVTLRCNHRDASMLGSLAYNVLLIALCTLYAFKTRKCPENFNEAKFIGFTMY
TTCIIWLAFLPIFYVTSSDYRVQTTTMCVSVSLSGSVVLGCLFAPKLYIILFQPQKNVVS
HRAPTSRFGSAAARASSSEFLEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
J9R	4-(1-methylpyrazol-4-yl)-7-[[(2~{S})-2-(trifluoromethyl)morpholin-4-yl]methyl]q…	C20 H20 F3 N5 O2	1
FMN	Flavin mononucleotide	C17 H21 N4 O9 P	1

Primary citation

Structures of human mGlu2 and mGlu7 homo- and heterodimers. Du, J., Wang, D., Fan, H. et al. Nature (2021) 594:589-593. DOI 10.1038/s41586-021-03641-w · PubMed

Other PDB entries of the same protein (UniProt P00323 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YOB 1.14 Å, Crystal Structure of flavodoxin without engineered disulfide bond
1F4P 1.3 Å, Y98W flavodoxin mutant 1.5A (D. Vulgaris)
1J8Q 1.35 Å, Low Temperature (100K) Crystal Structure of Flavodoxin D. vulgaris Wild-type at 1.35…
5YOE 1.35 Å, Crystal Structure of flavodoxin with engineered disulfide bond A43C-L74C
5YOG 1.42 Å, Crystal Structure of flavodoxin with engineered disulfide bond N14C-C93
1J9E 1.44 Å, Low Temperature (100K) Crystal Structure of Flavodoxin D. vulgaris S35C Mutant at 1.44…
5YOC 1.5 Å, Crystal Structure of flavodoxin with engineered disulfide bond C102-R125C
1AKR 1.58 Å, G61A oxidized flavodoxin mutant
1WSW 1.69 Å, Low Temperature (100K) Crystal Structure Of Flavodoxin Mutant S64C, dimer, semiquinone…
1XYY 1.7 Å, Low Temperature (100K) Crystal Structure Of Flavodoxin Mutant S64C, homodimer, oxidised…
1AKW 1.75 Å, G61L oxidized flavodoxin mutant
1XYV 1.79 Å, Low Temperature (100K) Crystal Structure Of Flavodoxin Mutant S64C, monomer, semiquinone…

Browse structure collections

About this viewer

MolViewer shows 7EPE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.