7EQ7: Annexin A2

Co-Crystal Structure Analysis of Annexin A2 and 5alpha-EAL. Determined by X-ray diffraction at 2.11 Å resolution. Released 11 May 2022.

Method: X-ray diffraction
Resolution: 2.11 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,720
Mol. weight: 38.74 kDa
Ligands: CA
Released: 11 May 2022

Explore 7EQ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EQ7 contains 20 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 0 β-strands

Element	Residues	Length
α-helix	28-30	3
α-helix	35-47	13
α-helix	53-60	8
α-helix	65-79	15
α-helix	83-90	8
α-helix	93-103	11
α-helix	106-118	13
α-helix	125-134	10
α-helix	137-151	15
α-helix	155-162	8
α-helix	165-175	11
α-helix	188-201	14
α-helix	210-219	10
α-helix	222-235	14
α-helix	240-247	8
α-helix	250-278	29
α-helix	285-294	10
α-helix	300-311	12
α-helix	315-322	8
α-helix	325-335	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Annexin A2	A	protein	339	Homo sapiens	P07355 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7EQ7_1 Annexin A2 (chains A)
MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNIL
TNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKG
LGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRA
EDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDM
LESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDM
LKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Co-Crystal Structure Analysis of Annexin A2 and 5alpha-EAL. Liu, X., Yang, G. To be published.

Other PDB entries of the same protein (UniProt P07355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HYV 1.42 Å, Human Annexin A2 with heparin hexasaccharide bound
1W7B 1.52 Å, Annexin A2: Does it induce membrane aggregation by a new multimeric state of the protein.
7QQM 1.6 Å, The PDZ domain of LRRC7 fused with ANXA2
7PC5 1.7 Å, The third PDZ domain of PDZD7 complexed with the PDZ-binding motif of EXOC4
7P73 1.85 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
2HYU 1.86 Å, Human Annexin A2 with heparin tetrasaccharide bound
7ZVN 1.87 Å, Crystal structure of human Annexin A2 in complex with full phosphorothioate 5-10…
5LPX 1.9 Å, Crystal structure of PKC phosphorylation-mimicking mutant (S26E) Annexin A2
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
7P70 2.0 Å, The PDZ-domain of SNTB1 complexed with the PDZ-binding motif of HPV35-E6
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2

Browse structure collections

About this viewer

MolViewer shows 7EQ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.