MEK1 bound to DS94070624. Determined by X-ray diffraction at 2.1 Å resolution. Released 1 Mar 2023.
Explore 7XNC in 3D Show helices and sheets RCSB PDB PDBe
7XNC contains 19 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 38-40 | 3 | |
| α-helix | 44-58 | 15 | |
| α-helix | 65-67 | 3 | |
| β-strand | 68-77 | 10 | 1 |
| β-strand | 80-87 | 8 | 1 |
| β-strand | 93-100 | 8 | 1 |
| α-helix | 105-115 | 11 | |
| α-helix | 116-120 | 5 | |
| β-strand | 126 | 1 | 2 |
| β-strand | 129-135 | 7 | 1 |
| β-strand | 138-144 | 7 | 1 |
| β-strand | 150 | 1 | 2 |
| α-helix | 151-158 | 8 | |
| α-helix | 163-184 | 22 | |
| α-helix | 193-195 | 3 | |
| β-strand | 196-198 | 3 | 2 |
| β-strand | 204-206 | 3 | 2 |
| α-helix | 213-218 | 6 | |
| α-helix | 242-258 | 17 | |
| α-helix | 265-267 | 3 | |
| α-helix | 268-274 | 7 | |
| α-helix | 310-319 | 10 | |
| α-helix | 321-323 | 3 | |
| α-helix | 325-326 | 2 | |
| α-helix | 332-341 | 10 | |
| α-helix | 352-356 | 5 | |
| α-helix | 359-366 | 8 | |
| α-helix | 371-379 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Dual specificity mitogen-activated protein kinase kinase 1 | A | protein | 348 | Homo sapiens | Q02750 (AlphaFold model) |
>7XNC_1 Dual specificity mitogen-activated protein kinase kinase 1 (chains A) GLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMA RKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVL KKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQL IDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMF GCQVEGDAAETPPRPRTPGRPLNKKGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQ DFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 3 |
| GIK | ~{N}-[4-[[6-(3-chloranylpyridin-4-yl)-3-methyl-1~{H}-indazol-4-yl]oxy]cyclohexy… | C21 H23 Cl N4 O2 | 1 |
Water and common crystallization additives (DMS) are not listed.
Discovery of a Novel ATP-Competitive MEK Inhibitor DS03090629 that Overcomes Resistance Conferred by BRAF Overexpression in BRAF-Mutated Melanoma. Takano, K., Munehira, Y., Hatanaka, M. et al. Mol Cancer Ther (2023) 22:317-332. DOI 10.1158/1535-7163.MCT-22-0306 · PubMed
Other PDB entries of the same protein (UniProt Q02750 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7XNC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.