7UHE: Taf14 ET domain

Taf14 ET domain in complex with C-terminal tail of Taf2. Determined by X-ray diffraction at 1.66 Å resolution. Released 17 Aug 2022.

Method: X-ray diffraction
Resolution: 1.66 Å
Organism: Saccharomyces
Chains: 4
Atoms: 1,453
Mol. weight: 19.68 kDa
Released: 17 Aug 2022

Explore 7UHE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UHE contains 8 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	172	1	1
β-strand	175	1	1
α-helix	177-186	10
α-helix	189-201	13
β-strand	209-212	4	2
β-strand	217-221	5	2
α-helix	222-224	3
α-helix	227-240	14

Chains B and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1396-1400	5	2

Chain C: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	171-172	2	3
β-strand	175-176	2	3
α-helix	177-186	10
α-helix	189-201	13
β-strand	209-212	4	4
β-strand	217-221	5	4
α-helix	222-224	3
α-helix	227-239	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 14	A, C	protein	76	Saccharomyces	P35189 (AlphaFold model)
C-terminal tail of Transcription initiation factor TFIID subunit 2	B, D	protein	12	Saccharomyces	P23255 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7UHE_1 Transcription initiation factor TFIID subunit 14 (chains A, C)
GSASTVKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLYSL
PEGLLKSLWDYVKKNT

Sequence of entity 2 (B, D), FASTA

>7UHE_2 C-terminal tail of Transcription initiation factor TFIID subunit 2 (chains B, D)
SRSFMVKIRTKN

Primary citation

Taf2 mediates DNA binding of Taf14. Klein, B.J., Feigerle, J.T., Zhang, J. et al. Nat Commun (2022) 13:3177-3177. DOI 10.1038/s41467-022-30937-w · PubMed

Other PDB entries of the same protein (UniProt P35189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QRL 1.7 Å, Crystal Structure of the Taf14 YEATS domain
6MIQ 1.75 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9bu
6MIO 1.85 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9pr
5D7E 1.9 Å, Crystal structure of Taf14 YEATS domain in complex with H3K9ac
6MIN 1.9 Å, Crystal structure of Taf14 YEATS domain G82A mutant in complex with histone H3K9cr
8U77 1.93 Å, Crystal structure of Taf14 in complex with Yng1
6MIP 2.0 Å, Crystal structure of Taf14 YEATS domain G82A mutant
7F4A 2.0 Å, Crystal structure of Taf14 YEATS domain in complex with H3K9bz peptide
5IOK 2.22 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9cr
9VKW 3.13 Å, Cryo-EM structure of the NuA3 complex bound to Ace-coenzyme A
9UUS 3.2 Å, The NuA3 histone acetyltransferase complex bound to acetyl-CoA and H3 tail
9UUO 3.68 Å, The NuA3 histone acetyltransferase complex

Browse structure collections

About this viewer

MolViewer shows 7UHE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.