7FCS: Apolipoprotein E

Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE). Determined by X-ray diffraction at 1.6 Å resolution. Released 20 Jul 2022.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,270
Mol. weight: 22.38 kDa
Released: 20 Jul 2022

Explore 7FCS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7FCS contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	25-42	18
α-helix	45-52	8
α-helix	55-78	24
α-helix	90-124	35
α-helix	131-162	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apolipoprotein E	A	protein	193	Homo sapiens	P02649 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7FCS_1 Apolipoprotein E (chains A)
GPKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQ
ELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVVGRLVQY
RGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIR
ERLGPLVEQGRVR

Primary citation

Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE). Cherakara, S., Kumar, A., Garai, K. et al. To be published.

Other PDB entries of the same protein (UniProt P02649 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7FCR 1.4 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
8AX9 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)
8AX8 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P3121)
1GS9 1.7 Å, Apolipoprotein E4, 22k domain
6NCO 1.71 Å, Fragment-based Discovery of an apoE4 Stabilizer
1OR3 1.73 Å, Apolipoprotein E3 (APOE3), trigonal truncation mutant 165
8CE0 1.75 Å, N-terminal domain of human apolipoprotein E
1NFN 1.8 Å, Apolipoprotein E3 (APOE3)
6NCN 1.82 Å, Fragment-based Discovery of an apoE4 Stabilizer
1BZ4 1.85 Å, Apolipoprotein E3 (apo-E3), truncation mutant 165
9SA6 1.89 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)
1H7I 1.9 Å, Apolipoprotein E3 22kD fragment LYS146GLN mutant

Browse structure collections

About this viewer

MolViewer shows 7FCS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.