Crystal Structure of Werner helicase fragment 517-945 in covalent complex with N-[(E,1S)-1-cyclopropyl-3-methylsulfonylprop-2-enyl]-2-(1,1-difluoroethyl)-4-phenoxypyrimidine-5-carboxamide. Determined by X-ray diffraction at 1.54 Å resolution. Released 1 May 2024.
Explore 7GQU in 3D Show helices and sheets RCSB PDB PDBe
7GQU contains 24 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 531-533 | 3 | |
| α-helix | 534-544 | 11 | |
| α-helix | 551-563 | 13 | |
| β-strand | 567-570 | 4 | 1 |
| α-helix | 579-588 | 10 | |
| β-strand | 591-595 | 5 | 1 |
| α-helix | 599-611 | 13 | |
| β-strand | 616-618 | 3 | 1 |
| α-helix | 625-632 | 8 | |
| β-strand | 638-641 | 4 | 1 |
| α-helix | 643-648 | 6 | |
| α-helix | 650-659 | 10 | |
| β-strand | 662-667 | 6 | 1 |
| α-helix | 670-673 | 4 | |
| α-helix | 682-688 | 7 | |
| α-helix | 689-693 | 5 | |
| β-strand | 699-703 | 5 | 1 |
| α-helix | 708-718 | 11 | |
| α-helix | 723 | 1 | |
| β-strand | 724-727 | 4 | 1 |
| β-strand | 735-741 | 7 | 2 |
| α-helix | 746-750 | 5 | |
| α-helix | 751-753 | 3 | |
| β-strand | 754-756 | 3 | 3 |
| β-strand | 761-763 | 3 | 3 |
| β-strand | 767-770 | 4 | 2 |
| α-helix | 774-786 | 13 | |
| β-strand | 791-795 | 5 | 2 |
| α-helix | 800-811 | 12 | |
| β-strand | 817-821 | 5 | 2 |
| β-strand | 835-839 | 5 | 2 |
| α-helix | 845-853 | 9 | |
| β-strand | 862-868 | 7 | 2 |
| α-helix | 873-875 | 3 | |
| α-helix | 886-904 | 19 | |
| α-helix | 909-915 | 7 | |
| α-helix | 920-923 | 4 | |
| α-helix | 924-929 | 6 | |
| β-strand | 936 | 1 | 2 |
| α-helix | 937-944 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN | A | protein | 439 | Homo sapiens | Q14191 (AlphaFold model) |
>7GQU_1 Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN (chains A) MNEGEEDDDKDFLWPAPNEEQVTCLKMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGY GKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLKMSNIPACFLGSAQSENVLTDIKLGK YRIVYVTPEYCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALP MVPIVALTATASSSIREDIVRCLNLRNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLV KTSSHWEFEGPTIIYCPSRKMTQQVTGELRKLNLSCGTYHAGMSFSTRKDIHHRFVRDEI QCVIATIAFGMGINKADIRQVIHYGAPKDMESYYQEIGRAGRDGLQSSCHVLWAPADINL NRHLLTEIRNEKFRLYKLKMMAKMEKYLHSSRCRRQIILSHFEDKQVQKASLGIMGTEKC CDNCRSRLDHGGRLEVLFQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
| X1L | N-[(1S)-1-cyclopropyl-3-(methanesulfonyl)propyl]-2-(1,1-difluoroethyl)-4-phenox… | C20 H23 F2 N3 O4 S | 1 |
Water and common crystallization additives (GOL, NA) are not listed.
Chemoproteomic discovery of a covalent allosteric inhibitor of WRN helicase. Baltgalvis, K.A., Lamb, K.N., Symons, K.T. et al. Nature (2024) 629:435-442. DOI 10.1038/s41586-024-07318-y · PubMed
Other PDB entries of the same protein (UniProt Q14191 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7GQU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.