7JJL: Importin Alpha 3

Crystal structure of Importin Alpha 3 in complex with human LSD1 NLS. Determined by X-ray diffraction at 2.6 Å resolution. Released 5 Aug 2020.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,231
Mol. weight: 54.27 kDa
Released: 5 Aug 2020

Explore 7JJL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JJL contains 31 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 0 β-strands

Element	Residues	Length
α-helix	73-80	8
α-helix	85-100	16
α-helix	107-112	6
α-helix	115-122	8
α-helix	129-142	14
α-helix	147-155	9
α-helix	159-165	7
α-helix	171-185	15
α-helix	189-197	9
α-helix	201-205	5
α-helix	214-228	15
α-helix	234-236	3
α-helix	237-250	14
α-helix	256-270	15
α-helix	274-282	9
α-helix	286-289	4
α-helix	290-294	5
α-helix	298-311	14
α-helix	316-323	8
α-helix	327-330	4
α-helix	331-335	5
α-helix	340-354	15
α-helix	358-366	9
α-helix	370-379	10
α-helix	382-398	17
α-helix	401-408	8
α-helix	413-417	5
α-helix	425-441	17
α-helix	447-456	10
α-helix	459-465	7
α-helix	471-482	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-3	A	protein	465	Homo sapiens	O00629 (AlphaFold model)
Lysine-specific histone demethylase 1A	B	protein	26	Homo sapiens	O60341 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7JJL_1 Importin subunit alpha-3 (chains A)
ENLYFQSGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGIL
PILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQ
AVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPP
METIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQ
EVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAG
NQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPF
CNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKL
AYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF

Sequence of entity 2 (B), FASTA

>7JJL_2 Lysine-specific histone demethylase 1A (chains B)
TPEGRRTSRRKRAKVEYREMDESLAN

Primary citation

Targeting Nuclear LSD1 to Reprogram Cancer Cells and Reinvigorate Exhausted T Cells via a Novel LSD1-EOMES Switch. Tu, W.J., McCuaig, R.D., Tan, A.H.Y. et al. Front Immunol (2020) 11:1228. DOI 10.3389/fimmu.2020.01228 · PubMed

Other PDB entries of the same protein (UniProt O00629 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BW9 1.6 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 1
8HKW 1.9 Å, Crystal structure of importin-alpha3 bound to the 53BP1 nuclear localization signal
7LFC 2.1 Å, Structure of importin a3 bound to p50 NLS
7RG5 2.15 Å, Importin alpha3 in complex with p50 NLS
6BWA 2.2 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 2
6BVV 2.3 Å, Nipah virus W protein C-terminus in complex with Importin alpha 3
6BVZ 2.3 Å, Importin alpha 3 in cargo free state
6BWB 2.3 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 3
6WX8 2.3 Å, SOX2 bound to Importin-alpha 3
7RFY 2.5 Å, Importin alpha3 in complex with MERS ORF4B
4UAE 2.7 Å, Importin alpha 3 delta IBB in complex with Influenza PB2 Nuclear Localization Domain
8FUB 2.75 Å, Crystal structure of human Importin alpha 3 in complex with Hendra virus matrix protein…

Browse structure collections

About this viewer

MolViewer shows 7JJL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.