7JM3: Matrix protein 1

Full-length three-dimensional structure of the influenza A virus M1 protein and its organization into a matrix layer. Determined by electron microscopy at 3.4 Å resolution. Released 12 Aug 2020.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)
Chains: 1
Atoms: 1,940
Mol. weight: 27.83 kDa
Released: 12 Aug 2020

Explore 7JM3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JM3 contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	9-12	4
α-helix	16	1
α-helix	19-33	15
α-helix	39-45	7
α-helix	54-67	14
α-helix	78-81	4
α-helix	90-92	3
α-helix	93-103	11
α-helix	110-117	8
α-helix	123-131	9
α-helix	140-150	11
α-helix	152-159	8
α-helix	171-194	24
α-helix	202-219	18
α-helix	230-236	7
α-helix	240-243	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Matrix protein 1	C	protein	251	Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)	P03485 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>7JM3_1 Matrix protein 1 (chains C)
SLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILG
FVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAKKLYRKLKREITFHGAKEISLSYSA
GALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVL
ASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQ
KRMGVQMQRFK

Primary citation

Full-length three-dimensional structure of the influenza A virus M1 protein and its organization into a matrix layer. Selzer, L., Su, Z., Pintilie, G.D. et al. PLoS Biol (2020) 18:e3000827-e3000827. DOI 10.1371/journal.pbio.3000827 · PubMed

Other PDB entries of the same protein (UniProt P03485 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VLL 1.6 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5TEZ 1.7 Å, TCR F50 recgonizing M1-HLA-A2
5ISZ 2.06 Å, Crystal structure of LS01-TCR/M1-HLA-A*02 complex
1AA7 2.08 Å, Influenza virus matrix protein crystal structure at PH 4.0
5CQE 2.1 Å, 2.1 Angstrom resolution crystal structure of matrix protein 1 (M1; residues 1-164) from…
5EUO 2.1 Å, PF6-M1-HLA-A2
1EA3 2.3 Å, Influenza virus M1 protein
2VLR 2.3 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5JHD 2.46 Å, Crystal structure of LS10-TCR/M1-HLA-A*02 complex
1HHI 2.5 Å, The antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation…
3VDX 3.0 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains
4IQ4 3.5 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains,…

Browse structure collections

About this viewer

MolViewer shows 7JM3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.