Crystal structure of EBOV glycoprotein with modified HR2 stalk at 2.3A resolution. Determined by X-ray diffraction at 2.28 Å resolution. Released 7 Apr 2021.
Explore 7JPI in 3D Show helices and sheets RCSB PDB PDBe
7JPI contains 12 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 35-39 | 5 | 1 |
| β-strand | 42-46 | 5 | 1 |
| α-helix | 60-62 | 3 | |
| β-strand | 63-69 | 7 | 1 |
| α-helix | 70-73 | 4 | |
| α-helix | 79-83 | 5 | |
| β-strand | 86-89 | 4 | 2 |
| β-strand | 96-98 | 3 | 1 |
| β-strand | 101 | 1 | 1 |
| β-strand | 102-103 | 2 | 3 |
| β-strand | 105-114 | 10 | 4 |
| β-strand | 120 | 1 | 4 |
| α-helix | 123-126 | 4 | |
| β-strand | 135-144 | 10 | 4 |
| β-strand | 151-154 | 4 | 2 |
| β-strand | 159-161 | 3 | 1 |
| β-strand | 165-167 | 3 | 1 |
| β-strand | 169 | 1 | 2 |
| β-strand | 176 | 1 | 4 |
| β-strand | 177-185 | 9 | 1 |
| α-helix | 188-190 | 3 | |
| β-strand | 216-223 | 8 | 4 |
| β-strand | 231-235 | 5 | 4 |
| β-strand | 240-243 | 4 | 4 |
| α-helix | 250-262 | 13 | |
| β-strand | 273-275 | 3 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 503 | 1 | 1 |
| β-strand | 515-519 | 5 | 3 |
| α-helix | 539-541 | 3 | |
| β-strand | 544-548 | 5 | 3 |
| α-helix | 551-553 | 3 | |
| α-helix | 554-575 | 22 | |
| β-strand | 580-581 | 2 | 1 |
| α-helix | 584-597 | 14 | |
| α-helix | 613-620 | 8 | |
| α-helix | 621-625 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Envelope glycoprotein | A | protein | 297 | Ebola virus - Mayinga, Zaire, 1976 | Q05320 (AlphaFold model) |
| Envelope glycoprotein | B | protein | 165 | Ebola virus - Mayinga, Zaire, 1976 | Q05320 (AlphaFold model) |
>7JPI_1 Envelope glycoprotein (chains A) MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSALQVSDVDKLVCRDKLSST NQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSE CLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGV VAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLT YVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAFWETXXXX
>7JPI_2 Envelope glycoprotein (chains B) EAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQL ANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDLTKNITD KIDQIIHDFVDKTLPDASGYIPEAPRDGQAYVRKDGEWVLLSTFL
Water and common crystallization additives (GOL) are not listed.
Single-component multilayered self-assembling nanoparticles presenting rationally designed glycoprotein trimers as Ebola virus vaccines. He, L., Chaudhary, A., Lin, X. et al. Nat Commun (2021) 12:2633-2633. DOI 10.1038/s41467-021-22867-w · PubMed
Other PDB entries of the same protein (UniProt Q05320 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7JPI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.