7JTL: SARS-CoV-2 ORF8 accessory protein

Structure of SARS-CoV-2 ORF8 accessory protein. Determined by X-ray diffraction at 2.04 Å resolution. Released 26 Aug 2020.

Method: X-ray diffraction
Resolution: 2.04 Å
Organism: Severe acute respiratory syndrome coronavirus 2
Chains: 2
Atoms: 1,825
Mol. weight: 24.47 kDa
Released: 26 Aug 2020

Explore 7JTL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JTL contains 4 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	20-25	6	1
β-strand	30-32	3	2
α-helix	33-35	3
α-helix	38	1
β-strand	42-49	8	1
β-strand	52	1	3
β-strand	57-59	3	1
β-strand	80-83	4	2
β-strand	86-89	4	2
β-strand	96-103	8	1
β-strand	111-120	10	1

Chain B: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	19-25	7	3
β-strand	30-32	3	4
α-helix	38	1
β-strand	42-49	8	3
β-strand	52	1	1
β-strand	57-59	3	3
α-helix	60	1
β-strand	80-83	4	4
β-strand	86-89	4	4
β-strand	96-103	8	3
β-strand	112-120	9	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ORF8 protein	A, B	protein	107	Severe acute respiratory syndrome coronavirus 2	P0DTC8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7JTL_1 ORF8 protein (chains A, B)
SNAQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYI
DIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Primary citation

Structure of SARS-CoV-2 ORF8, a rapidly evolving immune evasion protein. Flower, T.G., Buffalo, C.Z., Hooy, R.M. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2021785118 · PubMed

Other PDB entries of the same protein (UniProt P0DTC8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7JX6 1.61 Å, Structure of the SARS-CoV-2 ORF8 encoded accessory protein
7F5F 1.62 Å, SARS-CoV-2 ORF8 S84
7F8L 1.76 Å, Crystal structure of Bat coronavirus RaTG13 ORF8 accessory protein
7XMN 2.3 Å, Structure of SARS-CoV-2 ORF8
7MX9 2.6 Å, Crystal structure of the SARS-CoV-2 ORF8 accessory protein

Browse more

7JTL is part of these collections:

SARS-CoV-2 and COVID-19

About this viewer

MolViewer shows 7JTL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.