7JU2: Monomeric ETV6 PNT domain

Crystal structure of the monomeric ETV6 PNT domain. Determined by X-ray diffraction at 1.85 Å resolution. Released 20 Jan 2021.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,439
Mol. weight: 20.27 kDa
Released: 20 Jan 2021

Explore 7JU2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JU2 contains 16 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	20-23	4
α-helix	26-28	3
α-helix	31-44	14
α-helix	47-49	3
α-helix	52-55	4
α-helix	59-64	6
α-helix	67-73	7
α-helix	78-90	13

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	20-22	3
α-helix	26-28	3
α-helix	31-45	15
α-helix	47-49	3
α-helix	52-55	4
α-helix	59-62	4
α-helix	67-73	7
α-helix	78-90	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor ETV6	A, B	protein	83	Homo sapiens	P41212 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7JU2_1 Transcription factor ETV6 (chains A, B)
MEEDSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKDLLLLTKEDF
RYRSPHSGDELYELLQHILKQRK

Primary citation

Biophysical characterization of the ETV6 PNT domain polymerization interfaces. Gerak, C.A.N., Cho, S.Y., Kolesnikov, M. et al. J Biol Chem (2021) 296:100284-100284. DOI 10.1016/j.jbc.2021.100284 · PubMed

Other PDB entries of the same protein (UniProt P41212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DOC 1.19 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
9ZB7 1.24 Å, A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion
9Q4D 1.3 Å, A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct…
7TW9 1.41 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin
1JI7 1.45 Å, Crystal Structure of TEL SAM Polymer
7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7TW8 1.55 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH
8FRJ 1.57 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946
9DB5 1.57 Å, A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker
8FT8 1.6 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
8FRK 1.61 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158
7TW7 1.62 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM

Browse structure collections

About this viewer

MolViewer shows 7JU2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.