7K3R: AIM2-PYD filament

Cryo-EM structure of AIM2-PYD filament. Determined by electron microscopy at 3.2 Å resolution. Released 26 May 2021.

Method: Electron microscopy
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 21
Atoms: 16,170
Mol. weight: 284.1 kDa
Released: 26 May 2021

Explore 7K3R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7K3R contains 168 α-helices and 0 β-strands across 21 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T and U: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	2-7	6
α-helix	8-14	7
α-helix	15-17	3
α-helix	20-28	9
α-helix	38-41	4
α-helix	46-57	12
α-helix	59-72	14
α-helix	76-93	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon-inducible protein AIM2	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U	protein	120	Homo sapiens	O14862 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U), FASTA

>7K3R_1 Interferon-inducible protein AIM2 (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U)
GTGMESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATLMIQNAG
AVSAVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYKSVTKPKPLSQAEMSPAASAAIRND

Primary citation

Distinct axial and lateral interactions within homologous filaments dictate the signaling specificity and order of the AIM2-ASC inflammasome. Matyszewski, M., Zheng, W., Lueck, J. et al. Nat Commun (2021) 12:2735-2735. DOI 10.1038/s41467-021-23045-8 · PubMed

Other PDB entries of the same protein (UniProt O14862 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4O7Q 1.82 Å, Crystal Structure of the F27G AIM2 Pyrin Domain Mutant and Similarities of its…
3VD8 2.07 Å, Crystal structure of human AIM2 PYD domain with MBP fusion
3RN5 2.5 Å, Structural basis of cytosolic DNA recognition by innate immune receptors
3RN2 2.55 Å, Structural Basis of Cytosolic DNA Recognition by Innate Immune Receptors
6MB2 5.0 Å, Cryo-EM structure of the PYD filament of AIM2

Browse structure collections

About this viewer

MolViewer shows 7K3R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.