7K7A: Transmembrane structure of TNFR1

Transmembrane structure of TNFR1. Determined by solution NMR. Released 30 Sept 2020.

Method: Solution NMR
Organism: Homo sapiens
Chains: 3
Atoms: 720
Mol. weight: 10.11 kDa
Released: 30 Sept 2020

Explore 7K7A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7K7A contains 3 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	213-236	24

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	213-237	25

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	213-235	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor superfamily member 1A	A, B, C	protein	30	Homo sapiens	P19438 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>7K7A_1 Tumor necrosis factor receptor superfamily member 1A (chains A, B, C)
GTTVLLPLVIFFGLALLSLLFIGLAYRYQR

Primary citation

The Diversity and Similarity of Transmembrane Trimerization of TNF Receptors. Zhao, L., Fu, Q., Pan, L. et al. Front Cell Dev Biol (2020) 8:569684-569684. DOI 10.3389/fcell.2020.569684 · PubMed

Other PDB entries of the same protein (UniProt P19438 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8P6Q 1.4 Å, Racemic structure of TNFR1 cysteine-rich domain
9S3I 1.64 Å, Crystal structure of the human tumor necrosis factor receptor 1 extracellular domain at…
9S3J 1.77 Å, Crystal structure of the human tumor necrosis factor receptor 1 extracellular domain in…
1EXT 1.85 Å, Extracellular domain of the 55KDA tumor necrosis factor receptor. Crystallized at PH3.7…
1NCF 2.25 Å, A new paradigm for tumor necrosis factor signalling
8ZUI 2.56 Å, Binary cluster of TNF-TNFR1 ectodomain complex
9V9C 2.62 Å, Cryo-EM structure of human TNFR1 DD filament
7KP7 2.65 Å, asymmetric mTNF-alpha hTNFR1 complex
1TNR 2.85 Å, Crystal structure of the soluble human 55 kd tnf receptor-human tnf-beta complex:…
1FT4 2.9 Å, Photochemically-enhanced binding of small molecules to the tumor necrosis factor…
7KPB 3.0 Å, Human TNF-alpha TNFR1 complex bound to conformationally selective antibody
7KP8 3.15 Å, asymmetric mTNF-alpha hTNFR1 complex

Browse structure collections

About this viewer

MolViewer shows 7K7A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.