MicroED structure of mVDAC. Determined by electron crystallography at 3.12 Å resolution. Released 23 Dec 2020.
Explore 7KUH in 3D Show helices and sheets RCSB PDB PDBe
7KUH contains 3 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| α-helix | 7-9 | 3 | |
| α-helix | 12-17 | 6 | |
| β-strand | 26-32 | 7 | 1 |
| β-strand | 38-48 | 11 | 1 |
| β-strand | 54-57 | 4 | 1 |
| β-strand | 60-64 | 5 | 1 |
| β-strand | 69-73 | 5 | 1 |
| β-strand | 83-88 | 6 | 1 |
| β-strand | 95-102 | 8 | 1 |
| β-strand | 111-120 | 10 | 1 |
| β-strand | 123-132 | 10 | 1 |
| β-strand | 135-144 | 10 | 1 |
| β-strand | 146 | 1 | 1 |
| β-strand | 149-158 | 10 | 1 |
| β-strand | 163-174 | 12 | 1 |
| β-strand | 178-185 | 8 | 1 |
| β-strand | 189-190 | 2 | 1 |
| β-strand | 193-197 | 5 | 1 |
| β-strand | 202-211 | 10 | 1 |
| β-strand | 217-225 | 9 | 1 |
| β-strand | 232-238 | 7 | 1 |
| β-strand | 242-252 | 11 | 1 |
| β-strand | 255-264 | 10 | 1 |
| β-strand | 275-282 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Voltage-dependent anion-selective channel protein 1 | X | protein | 295 | Mus musculus | Q60932 (AlphaFold model) |
>7KUH_1 Voltage-dependent anion-selective channel protein 1 (chains X) MRGSHHHHHHGSMAVPPTYADLGESARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSAN TETTKVNGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTG KKNAKIKTGYKREHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSN FAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVD PDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
MicroED structure of lipid-embedded mammalian mitochondrial voltage-dependent anion channel. Martynowycz, M.W., Khan, F., Hattne, J. et al. Proc Natl Acad Sci U S A (2020) 117:32380-32385. DOI 10.1073/pnas.2020010117 · PubMed
Other PDB entries of the same protein (UniProt Q60932 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7KUH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.