7L7J: Hsp90:p23 closed-state complex

Name: PDB 7L7J: Cryo-EM structure of Hsp90:p23 closed-state complex
Published: 2021-08-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Cryo-EM structure of Hsp90:p23 closed-state complex. Determined by electron microscopy at 3.1 Å resolution. Released 25 Aug 2021.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 3
Atoms: 11,196
Mol. weight: 189.3 kDa
Ligands: ANP
Released: 25 Aug 2021

Explore 7L7J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7L7J contains 63 α-helices and 70 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	18-21	4	4
β-strand	23-24	2	5
α-helix	26-35	10
α-helix	41-43	3
α-helix	44-65	22
α-helix	67-70	4
β-strand	78-83	6	6
β-strand	88-93	6	6
α-helix	100-102	3
α-helix	103-107	5
β-strand	109-110	2	7
α-helix	114-121	8
α-helix	137-140	4
α-helix	141-144	4
β-strand	145-153	9	6
β-strand	160-164	5	6
β-strand	169-174	6	6
β-strand	183-190	8	6
α-helix	195-198	4
α-helix	200-210	11
β-strand	218-222	5	6
β-strand	285-287	3	6
α-helix	296-298	3
α-helix	306-317	12
β-strand	325-331	7	8
β-strand	337-343	7	8
β-strand	360-365	6	8
β-strand	368-372	5	8
α-helix	380-382	3
β-strand	386-391	6	8
β-strand	396	1	9
β-strand	403	1	9
α-helix	406-427	22
α-helix	431-451	21
α-helix	456-459	4
β-strand	464-465	2	10
β-strand	466-467	2	11
β-strand	475-476	2	10
α-helix	477-483	7
β-strand	490-495	6	11
α-helix	499-503	5
α-helix	506-508	3
α-helix	509-514	6
β-strand	519-521	3	11
α-helix	525-532	8
β-strand	535-536	2	11
β-strand	539-543	5	11
β-strand	546	1	12
α-helix	555-578	24
β-strand	585-588	4	12
β-strand	597-601	5	12
α-helix	608-614	7
α-helix	622-625	4
α-helix	626-628	3
β-strand	632-636	5	12
α-helix	641-652	12
α-helix	657-673	17
α-helix	676-678	3
α-helix	681-696	16

Chain B: 32 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	18-21	4	6
β-strand	23-24	2	7
α-helix	26-35	10
α-helix	41-43	3
α-helix	44-64	21
α-helix	67-70	4
β-strand	78-83	6	4
β-strand	88-93	6	4
α-helix	100-102	3
α-helix	103-107	5
β-strand	109-110	2	5
α-helix	114-119	6
α-helix	137-143	7
β-strand	145-153	9	4
β-strand	159-164	6	4
β-strand	169-174	6	4
β-strand	183-190	8	4
α-helix	192-198	7
α-helix	200-211	12
β-strand	218-221	4	4
β-strand	286-287	2	4
α-helix	296-298	3
α-helix	306-317	12
β-strand	323-331	9	13
β-strand	337-344	8	13
β-strand	361-365	5	13
β-strand	368-371	4	13
α-helix	380-382	3
β-strand	386-391	6	13
β-strand	396	1	14
β-strand	403	1	14
α-helix	407-427	21
α-helix	431-451	21
α-helix	456-460	5
β-strand	464-465	2	15
β-strand	466-467	2	16
β-strand	475-476	2	15
α-helix	477-483	7
β-strand	490-495	6	16
α-helix	499-503	5
α-helix	506-508	3
α-helix	509-514	6
β-strand	519-521	3	16
α-helix	525-530	6
β-strand	535-536	2	16
β-strand	539-543	5	16
β-strand	546	1	17
α-helix	555-567	13
α-helix	569-578	10
β-strand	585-588	4	17
β-strand	597-601	5	17
α-helix	602	1
β-strand	606	1	18
α-helix	608-614	7
α-helix	622-624	3
α-helix	625-628	4
β-strand	629	1	18
α-helix	630-631	2
β-strand	632-636	5	17
α-helix	641-652	12
α-helix	657-673	17
α-helix	676-678	3
α-helix	681-696	16

Chain C: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
β-strand	6-10	5	1
β-strand	14-19	6	1
β-strand	25-32	8	2
β-strand	35-41	7	2
β-strand	48-54	7	2
β-strand	55	1	3
β-strand	59-68	10	1
β-strand	73-79	7	1
β-strand	90	1	3
β-strand	99-101	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prostaglandin E synthase 3	C	protein	160	Homo sapiens	Q15185 (AlphaFold model)
Heat shock protein HSP 90-alpha	A, B	protein	732	Homo sapiens	P07900 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>7L7J_1 Prostaglandin E synthase 3 (chains C)
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID
PNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNF
DRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Sequence of entity 2 (A, B), FASTA

>7L7J_2 Heat shock protein HSP 90-alpha (chains A, B)
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRN
PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDY
CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKT
LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK
DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLE
GDDDTSRMEEVD

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	2

Primary citation

The structure of an Hsp90-immunophilin complex reveals cochaperone recognition of the client maturation state. Lee, K., Thwin, A.C., Nadel, C.M. et al. Mol Cell (2021) 81:3496. DOI 10.1016/j.molcel.2021.07.023 · PubMed

Other PDB entries of the same protein (UniProt Q15185 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EJF 2.49 Å, Crystal structure of the human co-chaperone P23
7KRJ 2.56 Å, The GR-Maturation Complex: Glucocorticoid Receptor in complex with Hsp90 and…
9W5I 2.63 Å, AGO maturation complex (AMC): AGO2-miRNA duplex in complex with Hsp90 beta and…
7L7I 3.3 Å, Cryo-EM structure of Hsp90:FKBP51:p23 closed-state complex

Browse structure collections

About this viewer

MolViewer shows 7L7J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.