7LF4: Importin a3

Structure of importin a3 bound to the p50- and p65-NLSs. Determined by X-ray diffraction at 2.85 Å resolution. Released 19 Jan 2022.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Homo sapiens
Chains: 6
Atoms: 6,859
Mol. weight: 125.24 kDa
Released: 19 Jan 2022

Explore 7LF4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LF4 contains 66 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 0 β-strands

Element	Residues	Length
α-helix	76-79	4
α-helix	85-100	16
α-helix	107-112	6
α-helix	116-122	7
α-helix	129-142	14
α-helix	147-155	9
α-helix	159-165	7
α-helix	171-185	15
α-helix	189-197	9
α-helix	201-206	6
α-helix	214-227	14
α-helix	234-236	3
α-helix	237-250	14
α-helix	256-272	17
α-helix	274-282	9
α-helix	286-289	4
α-helix	290-294	5
α-helix	298-312	15
α-helix	316-324	9
α-helix	327-330	4
α-helix	331-335	5
α-helix	340-354	15
α-helix	358-366	9
α-helix	369-379	11
α-helix	382-398	17
α-helix	401-409	9
α-helix	413-418	6
α-helix	419-421	3
α-helix	425-441	17
α-helix	446-455	10
α-helix	458-465	8
α-helix	471-484	14

Chains B and F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	439-442	4

Chain C: 32 helices, 0 β-strands

Element	Residues	Length
α-helix	79-81	3
α-helix	85-100	16
α-helix	107-112	6
α-helix	115-122	8
α-helix	129-142	14
α-helix	147-155	9
α-helix	159-165	7
α-helix	171-185	15
α-helix	189-197	9
α-helix	201-206	6
α-helix	214-228	15
α-helix	234-236	3
α-helix	237-250	14
α-helix	256-271	16
α-helix	274-282	9
α-helix	286-289	4
α-helix	290-294	5
α-helix	298-312	15
α-helix	316-324	9
α-helix	328-330	3
α-helix	331-335	5
α-helix	340-354	15
α-helix	358-366	9
α-helix	369-379	11
α-helix	382-398	17
α-helix	401-409	9
α-helix	413-418	6
α-helix	419-421	3
α-helix	425-441	17
α-helix	446-455	10
α-helix	458-465	8
α-helix	471-484	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-3	A, C	protein	521	Homo sapiens	O00629 (AlphaFold model)
Nuclear factor NF-kappa-B p105 subunit	B, F	protein	14	Homo sapiens	P19838 (AlphaFold model)
Transcription factor p65	D, E	protein	22	Homo sapiens	Q04206 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7LF4_1 Importin subunit alpha-3 (chains A, C)
MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDS
DIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILV
HCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWA
LGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETI
QEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKV
QTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQ
VQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLL
TVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEI
IDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF

Sequence of entity 2 (B, F), FASTA

>7LF4_2 Nuclear factor NF-kappa-B p105 subunit (chains B, F)
DKEEVQRKRQKLMP

Sequence of entity 3 (D, E), FASTA

>7LF4_3 Transcription factor p65 (chains D, E)
DRHRIEEKRKRTYETFKSIMKK

Primary citation

Differential recognition of canonical NF-kappa B dimers by Importin alpha 3. Florio, T.J., Lokareddy, R.K., Yeggoni, D.P. et al. Nat Commun (2022) 13:1207-1207. DOI 10.1038/s41467-022-28846-z · PubMed

Other PDB entries of the same protein (UniProt O00629 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BW9 1.6 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 1
8HKW 1.9 Å, Crystal structure of importin-alpha3 bound to the 53BP1 nuclear localization signal
7LFC 2.1 Å, Structure of importin a3 bound to p50 NLS
7RG5 2.15 Å, Importin alpha3 in complex with p50 NLS
6BWA 2.2 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 2
6BVV 2.3 Å, Nipah virus W protein C-terminus in complex with Importin alpha 3
6BVZ 2.3 Å, Importin alpha 3 in cargo free state
6BWB 2.3 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 3
6WX8 2.3 Å, SOX2 bound to Importin-alpha 3
7RFY 2.5 Å, Importin alpha3 in complex with MERS ORF4B
7JJL 2.6 Å, Crystal structure of Importin Alpha 3 in complex with human LSD1 NLS
4UAE 2.7 Å, Importin alpha 3 delta IBB in complex with Influenza PB2 Nuclear Localization Domain

Browse structure collections

About this viewer

MolViewer shows 7LF4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.