7LF4: Importin a3

Structure of importin a3 bound to the p50- and p65-NLSs. Determined by X-ray diffraction at 2.85 Å resolution. Released 19 Jan 2022.

Method

X-ray diffraction

Resolution

2.85 Å

Organism

Homo sapiens

Chains

6

Atoms

6,859

Mol. weight

125.24 kDa

Released

19 Jan 2022

Explore 7LF4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LF4 contains 66 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 0 β-strands

Molecules and chains

>7LF4_1 Importin subunit alpha-3 (chains A, C)
MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDS
DIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILV
HCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWA
LGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETI
QEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKV
QTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQ
VQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLL
TVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEI
IDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF

>7LF4_2 Nuclear factor NF-kappa-B p105 subunit (chains B, F)
DKEEVQRKRQKLMP

>7LF4_3 Transcription factor p65 (chains D, E)
DRHRIEEKRKRTYETFKSIMKK

Primary citation

Differential recognition of canonical NF-kappa B dimers by Importin alpha 3. Florio, T.J., Lokareddy, R.K., Yeggoni, D.P. et al. Nat Commun (2022) 13:1207-1207. DOI 10.1038/s41467-022-28846-z · PubMed

Related structures

Other PDB entries of the same protein (UniProt O00629 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 6BW9 1.6 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 1
• 8HKW 1.9 Å, Crystal structure of importin-alpha3 bound to the 53BP1 nuclear localization signal
• 7LFC 2.1 Å, Structure of importin a3 bound to p50 NLS
• 7RG5 2.15 Å, Importin alpha3 in complex with p50 NLS
• 6BWA 2.2 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 2
• 6BVV 2.3 Å, Nipah virus W protein C-terminus in complex with Importin alpha 3
• 6BVZ 2.3 Å, Importin alpha 3 in cargo free state
• 6BWB 2.3 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 3
• 6WX8 2.3 Å, SOX2 bound to Importin-alpha 3
• 7RFY 2.5 Å, Importin alpha3 in complex with MERS ORF4B
• 7JJL 2.6 Å, Crystal structure of Importin Alpha 3 in complex with human LSD1 NLS
• 4UAE 2.7 Å, Importin alpha 3 delta IBB in complex with Influenza PB2 Nuclear Localization Domain

Browse structure collections

About this viewer

MolViewer shows 7LF4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.