7LIE: Acid-sensing ion channel 1

The isolated chicken ASIC1a thumb domain (ATD-c1a) retains the structure and ligand binding properties of the full length chicken ASIC1a. Determined by solution NMR. Released 10 Aug 2022.

Method: Solution NMR
Organism: Gallus gallus
Chains: 1
Atoms: 613
Mol. weight: 8.92 kDa
Released: 10 Aug 2022

Explore 7LIE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LIE contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	304-321	18
α-helix	330	1
α-helix	334-337	4
α-helix	338-352	15
α-helix	363-366	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acid-sensing ion channel 1	A	protein	78	Gallus gallus	Q1XA76 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7LIE_1 Acid-sensing ion channel 1 (chains A)
SCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPAL
DFLVEKDNEYCVCEMPCN

Primary citation

A reductionist approach for studying the ASIC thumb domain to screen for channel modulators as novel therapeutic leads. Mishra, B.M., Mobli, M. To be published.

Other PDB entries of the same protein (UniProt Q1XA76 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QTS 1.9 Å, Structure of an acid-sensing ion channel 1 at 1.9 A resolution and low pH
4NTW 2.07 Å, Structure of acid-sensing ion channel in complex with snake toxin
4NTX 2.27 Å, Structure of acid-sensing ion channel in complex with snake toxin and amiloride
3S3W 2.6 Å, Structure of chicken acid-sensing ion channel 1 at 2.6 a resolution and ph 7.5
4NTY 2.65 Å, Cesium sites in the crystal structure of acid-sensing ion channel in complex with snake…
4FZ0 2.8 Å, Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at low pH
6VTK 2.82 Å, Structure of an acid-sensing ion channel solubilized by styrene maleic acid and in a…
5WKU 2.95 Å, Structure of an acid sensing ion channel in a resting state with barium
3S3X 2.99 Å, Structure of chicken acid-sensing ion channel 1 AT 3.0 A resolution in complex with…
3IJ4 3.0 Å, Cesium sites in the crystal structure of a functional acid sensing ion channel in the…
4NYK 3.0 Å, Structure of a membrane protein
6X9H 3.01 Å, Molecular mechanism and structural basis of small-molecule modulation of acid-sensing…

Browse structure collections

About this viewer

MolViewer shows 7LIE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.