X-ray structure of SPOP MATH domain (D140G) in complex with a 53BP1 peptide. Determined by X-ray diffraction at 1.44 Å resolution. Released 14 Apr 2021.
Explore 7LIN in 3D Show helices and sheets RCSB PDB PDBe
7LIN contains 6 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 29-38 | 10 | 1 |
| α-helix | 41-43 | 3 | |
| β-strand | 52-53 | 2 | 2 |
| α-helix | 54-56 | 3 | |
| β-strand | 57 | 1 | 2 |
| β-strand | 66-72 | 7 | 2 |
| α-helix | 78-80 | 3 | |
| β-strand | 83-92 | 10 | 2 |
| β-strand | 98-107 | 10 | 1 |
| β-strand | 113-118 | 6 | 1 |
| β-strand | 123-125 | 3 | 1 |
| β-strand | 130-138 | 9 | 2 |
| α-helix | 139-142 | 4 | |
| α-helix | 145-147 | 3 | |
| α-helix | 151-153 | 3 | |
| β-strand | 155-164 | 10 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1642 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Speckle-type POZ protein | A | protein | 143 | Homo sapiens | O43791 (AlphaFold model) |
| TP53-binding protein 1 peptide | B | protein | 15 | Homo sapiens | Q12888 (AlphaFold model) |
>7LIN_1 Speckle-type POZ protein (chains A) GPGHMVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDY LSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRGFLL DEANGLLPDDKLTLFCEVSVVQD
>7LIN_2 TP53-binding protein 1 peptide (chains B) PATPTASSSSSTTPT
ATM-phosphorylated SPOP contributes to 53BP1 exclusion from chromatin during DNA replication. Wang, D., Ma, J., Botuyan, M.V. et al. Sci Adv (2021) 7. DOI 10.1126/sciadv.abd9208 · PubMed
Other PDB entries of the same protein (UniProt O43791 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7LIN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.