7LK3: Untwinned human GABARAPL2

Crystal structure of untwinned human GABARAPL2. Determined by X-ray diffraction at 1.9 Å resolution. Released 12 May 2021.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,098
Mol. weight: 28.13 kDa
Released: 12 May 2021

Explore 7LK3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LK3 contains 16 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	36	1
α-helix	42-44	3
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-67	11
β-strand	77-79	3	1
β-strand	80	1	3
β-strand	83	1	3
α-helix	84-86	3
β-strand	90	1	2
α-helix	91-98	8
α-helix	104	1
β-strand	105-110	6	1

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	4
α-helix	36	1
α-helix	42-44	3
β-strand	48-52	5	4
β-strand	56	1	5
α-helix	57-68	12
β-strand	77-79	3	4
β-strand	80	1	6
β-strand	83	1	6
α-helix	84-86	3
β-strand	90	1	5
α-helix	91-98	8
α-helix	104	1
β-strand	105-110	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor-associated protein-like 2	A, B	protein	121	Homo sapiens	P60520 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7LK3_1 Gamma-aminobutyric acid receptor-associated protein-like 2 (chains A, B)
GAMSMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDIT
VAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG
F

Primary citation

A new crystal form of GABARAPL2. Scicluna, K., Dewson, G., Czabotar, P.E. et al. Acta Crystallogr F Struct Biol Commun (2021) 77:140-147. DOI 10.1107/S2053230X21004489 · PubMed

Other PDB entries of the same protein (UniProt P60520 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Q6Q 1.8 Å, Structure of human immunity related GTPase Q in complex with GABARAPL2.
7YO8 1.8 Å, Crystal structure of fission yeast Hfl1 LIR fused to human GABARAPL2
4CO7 2.0 Å, Crystal structure of human GATE-16
6H8C Structure of the human GABARAPL2 protein in complex with the UBA5 LIR motif

Browse structure collections

About this viewer

MolViewer shows 7LK3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.