8Q6Q: Human immunity related GTPase Q

Structure of human immunity related GTPase Q in complex with GABARAPL2. Determined by X-ray diffraction at 1.8 Å resolution. Released 28 Aug 2024.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,675
Mol. weight: 66.57 kDa
Ligands: CIT
Released: 28 Aug 2024

Explore 8Q6Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Q6Q contains 26 α-helices and 29 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	36	1
α-helix	42-43	2
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-67	11
β-strand	77-79	3	1
β-strand	80	1	3
β-strand	83	1	3
α-helix	84-86	3
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Chain B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
α-helix	11-24	14
β-strand	28-35	8	5
α-helix	36	1
α-helix	42-43	2
β-strand	48-52	5	5
β-strand	56	1	6
α-helix	57-68	12
β-strand	77-79	3	5
β-strand	80	1	7
β-strand	83	1	7
α-helix	84-86	3
β-strand	90	1	6
α-helix	91-98	8
β-strand	105-110	6	5

Chain C: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	4
α-helix	20-28	9
α-helix	32-34	3
β-strand	50-51	2	4
β-strand	56-62	7	4
α-helix	68-72	5
β-strand	77-82	6	4
α-helix	94-105	12
β-strand	110-115	6	4
α-helix	124-137	14
β-strand	144-148	5	4
α-helix	159-175	17
α-helix	176-178	3
β-strand	187-188	2	1

Chain D: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	8
α-helix	20-28	9
β-strand	50-51	2	8
β-strand	56-62	7	8
α-helix	68-72	5
β-strand	77-82	6	8
α-helix	94-105	12
β-strand	110-115	6	8
α-helix	124-137	14
β-strand	144-148	5	8
α-helix	159-175	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor-associated protein-like 2	A, B	protein	117	Homo sapiens	P60520 (AlphaFold model)
Immunity-related GTPase family Q protein	C, D	protein	192	Homo sapiens	Q8WZA9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8Q6Q_1 Gamma-aminobutyric acid receptor-associated protein-like 2 (chains A, B)
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF

Sequence of entity 2 (C, D), FASTA

>8Q6Q_2 Immunity-related GTPase family Q protein (chains C, D)
MPPPQGDVTALFLGPPGLGKSALIAALCDKDVETLEAPEGRPDSGVPSLRAAGPGLFLGE
LSCPPAAPGPWAAEANVLVLVLPGPEGNGEPLAPALGEAALAALARGTPLLAVRNLRPGD
SQTAAQARDQTAALLNSAGLGAADLFVLPANCGSSDGCEELERLRAALQSQAEALRRLLP
PAQDGFEVLGAA

Ligands and cofactors

ID	Name	Formula	Copies
CIT	Citric acid	C6 H8 O7	4

Primary citation

Structure of human immunity related GTPase Q in complex with GABARAPL2. Bailey, H.J., Misra, M., Pomirska, J. et al. To be published.

Other PDB entries of the same protein (UniProt P60520 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7YO8 1.8 Å, Crystal structure of fission yeast Hfl1 LIR fused to human GABARAPL2
7LK3 1.9 Å, Crystal structure of untwinned human GABARAPL2
4CO7 2.0 Å, Crystal structure of human GATE-16
6H8C Structure of the human GABARAPL2 protein in complex with the UBA5 LIR motif

Browse structure collections

About this viewer

MolViewer shows 8Q6Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.