6H8C: Human GABARAPL2 protein

Structure of the human GABARAPL2 protein in complex with the UBA5 LIR motif. Determined by solution NMR. Released 1 May 2019.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,097
Mol. weight: 15.64 kDa
Released: 1 May 2019

Explore 6H8C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6H8C contains 6 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	36	1
α-helix	42-43	2
β-strand	47-52	6	1
β-strand	56	1	2
α-helix	57-68	12
β-strand	77-80	4	1
β-strand	83	1	1
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	342-345	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor-associated protein-like 2	A	protein	116	Homo sapiens	P60520 (AlphaFold model)
Ubiquitin-like modifier-activating enzyme 5	B	protein	19	Homo sapiens	Q9GZZ9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6H8C_1 Gamma-aminobutyric acid receptor-associated protein-like 2 (chains A)
MGWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG

Sequence of entity 2 (B), FASTA

>6H8C_2 Ubiquitin-like modifier-activating enzyme 5 (chains B)
GAMEIIHEDNEWGIELVSE

Primary citation

An atypical LIR motif within UBA5 (ubiquitin like modifier activating enzyme 5) interacts with GABARAP proteins and mediates membrane localization of UBA5. Huber, J., Obata, M., Gruber, J. et al. Autophagy (2020) 16:256-270. DOI 10.1080/15548627.2019.1606637 · PubMed

Other PDB entries of the same protein (UniProt P60520 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Q6Q 1.8 Å, Structure of human immunity related GTPase Q in complex with GABARAPL2.
7YO8 1.8 Å, Crystal structure of fission yeast Hfl1 LIR fused to human GABARAPL2
7LK3 1.9 Å, Crystal structure of untwinned human GABARAPL2
4CO7 2.0 Å, Crystal structure of human GATE-16

Browse structure collections

About this viewer

MolViewer shows 6H8C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.