7LP2: Nedd4L WW3 domain

Structure of Nedd4L WW3 domain. Determined by X-ray diffraction at 1.88 Å resolution. Released 28 Jul 2021.

Method: X-ray diffraction
Resolution: 1.88 Å
Organism: Homo sapiens
Chains: 6
Atoms: 1,307
Mol. weight: 19.5 kDa
Released: 28 Jul 2021

Explore 7LP2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LP2 contains 13 α-helices and 10 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	387-388	2
β-strand	391-395	5	1
β-strand	400	1	2
β-strand	401-405	5	1
β-strand	410-412	3	1
α-helix	415-416	2

Chains B, D and F: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	238-242	5
α-helix	244-246	3

Chain C: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	387-388	2
β-strand	391-395	5	3
β-strand	401-405	5	3
β-strand	410-412	3	3
α-helix	415-416	2

Chain E: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	-2--1	2
α-helix	388	1
β-strand	391-395	5	2
β-strand	401-405	5	2
β-strand	410-412	3	2
α-helix	415-416	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase	A, C, E	protein	38	Homo sapiens	Q96PU5 (AlphaFold model)
Angiomotin	B, D, F	protein	15	Homo sapiens	Q4VCS5 (AlphaFold model)

Sequence of entity 1 (A, C, E), FASTA

>7LP2_1 E3 ubiquitin-protein ligase (chains A, C, E)
QPHMPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIM

Sequence of entity 2 (B, D, F), FASTA

>7LP2_2 Angiomotin (chains B, D, F)
MEHRGPPPEYPFKGM

Primary citation

Interactions between AMOT PPxY motifs and NEDD4L WW domains function in HIV-1 release. Rheinemann, L., Thompson, T., Mercenne, G. et al. J Biol Chem (2021) 297:100975-100975. DOI 10.1016/j.jbc.2021.100975 · PubMed

Other PDB entries of the same protein (UniProt Q96PU5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LP1 1.35 Å, Structure of Nedd4L WW3 domain
7LP3 1.61 Å, Structure of Nedd4L WW3 domain
6ZBT 1.8 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser342
2NSQ 1.85 Å, Crystal structure of the C2 domain of the human E3 ubiquitin-protein ligase NEDD4-like…
6ZC9 1.9 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser448
2ONI 2.2 Å, Catalytic Domain of the Human NEDD4-like E3 Ligase
7NMZ 2.3 Å, Structure of 14-3-3 eta in complex with Nedd4-2(335-455) containing two 14-3-3 binding…
5HPK 2.43 Å, System-wide modulation of HECT E3 ligases with selective ubiquitin variant probes:…
9Z5Q 3.06 Å, HECT domain of NEDD4-2 complex with a targeted nanobody, nb.C11
3JW0 3.1 Å, E2~Ubiquitin-HECT
3JVZ 3.3 Å, E2~Ubiquitin-HECT
9GIK 3.58 Å, Full-lenght Nedd4-2 E3 ubiquitin ligase

Browse structure collections

About this viewer

MolViewer shows 7LP2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.