Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A, crystallized in the presence of Cu(II). Determined by X-ray diffraction at 1.26 Å resolution. Released 23 Feb 2022.
Explore 7LSJ in 3D Show helices and sheets RCSB PDB PDBe
7LSJ contains 11 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-19 | 17 | |
| α-helix | 23-40 | 18 | |
| α-helix | 46-48 | 3 | |
| α-helix | 56-80 | 25 | |
| α-helix | 84-92 | 9 | |
| α-helix | 94-105 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-19 | 17 | |
| α-helix | 23-40 | 18 | |
| α-helix | 46-48 | 3 | |
| α-helix | 56-80 | 25 | |
| α-helix | 84-105 | 22 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Soluble cytochrome b562 | A, C | protein | 106 | Escherichia coli | P0ABE7 (AlphaFold model) |
>7LSJ_1 Soluble cytochrome b562 (chains A, C) ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMWH FRAGFDHLVGHIDDALKLANEGKVKEAQAAAEQLKCHCNHCHQHYR
Structure-guided metal selectivity in malleable protein interface mediated by single disulfide bond. Choi, T.S., Tezcan, F.A. To be published.
Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7LSJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.