7LSN: Soluble cytochrome b562

Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A, crystallized in the presence of Ni(II). Determined by X-ray diffraction at 1.52 Å resolution. Released 23 Feb 2022.

Method: X-ray diffraction
Resolution: 1.52 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,915
Mol. weight: 25.06 kDa
Ligands: NI, HEC
Released: 23 Feb 2022

Explore 7LSN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LSN contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	3-19	17
α-helix	23-41	19
α-helix	46-48	3
α-helix	56-80	25
α-helix	84-92	9
α-helix	95-105	11

Chain C: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	3-19	17
α-helix	23-40	18
α-helix	46-48	3
α-helix	56-80	25
α-helix	84-92	9
α-helix	95-105	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble cytochrome b562	A, C	protein	106	Escherichia coli	P0ABE7 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7LSN_1 Soluble cytochrome b562 (chains A, C)
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMWH
FRAGFDHLVGHIDDALKLANEGKVKEAQAAAEQLKCHCNHCHQHYR

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	2
HEC	Heme C	C34 H36 Fe N4 O4	2

Primary citation

Structure-guided metal selectivity in malleable protein interface mediated by single disulfide bond. Choi, T.S., Tezcan, F.A. To be published.

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 7LSN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.