ATAD2 bromodomain complexed with histone H4K5ac (res 1-10) ligand. Determined by X-ray diffraction at 1.6 Å resolution. Released 22 Sept 2021.
Explore 7M98 in 3D Show helices and sheets RCSB PDB PDBe
7M98 contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 980-1002 | 23 | |
| α-helix | 1004-1009 | 6 | |
| α-helix | 1021-1024 | 4 | |
| α-helix | 1031-1039 | 9 | |
| α-helix | 1046-1063 | 18 | |
| α-helix | 1069-1092 | 24 | |
| α-helix | 1095-1108 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ATPase family AAA domain-containing protein 2 | A | protein | 152 | Homo sapiens | Q6PL18 (AlphaFold model) |
| Histone H4 | B | protein | 15 | Homo sapiens | P62805 (AlphaFold model) |
>7M98_1 ATPase family AAA domain-containing protein 2 (chains A) GPLGSEPRSLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPD YVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACA LRDTAYAIIKEELDEDFEQLAEEIQESRKKRG
>7M98_2 Histone H4 (chains B) SGRGKGGKGLGKGGA
Coordination of Di-Acetylated Histone Ligands by the ATAD2 Bromodomain. Evans, C.M., Phillips, M., Malone, K.L. et al. Int J Mol Sci (2021) 22. DOI 10.3390/ijms22179128 · PubMed
Other PDB entries of the same protein (UniProt Q6PL18 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7M98 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.